PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_021658581.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Micrandreae; Hevea
Family EIL
Protein Properties Length: 619aa    MW: 69651.6 Da    PI: 6.3036
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_021658581.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN34172e-127774051303
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     eel++rmwkdq++lkr+ker+k   e+++a ++++k ++ ++qa+rkk+sraQDgiLkYMlk mevc+a+GfvYgiipekgk v+g+sd++raWW
  XP_021658581.1  77 EELERRMWKDQIKLKRIKERHKF--EAQQA-AEEQKLKHNSDQAQRKKVSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKAVSGSSDNIRAWW 168
                     8**************99999886..45665.89999*********************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdq 190
                     kekv+fd+ngpaai+ky+a++l+l++++++  +++++++ l++lqD+tlgSLLs+lmqhcdppqr++plek v+pPWWPtG+e+ww +lgl++ q
  XP_021658581.1 169 KEKVKFDKNGPAAIAKYEAECLALGEANKN--RNKKSQSILQDLQDATLGSLLSSLMQHCDPPQRKYPLEKRVPPPWWPTGNEEWWLKLGLPQGQ 261
                     *************************99888..67899999******************************************************* PP

                     -.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.........XXXXXXXXXXX CS
            EIN3 191 gtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.........slrkqspkvtl 276
                     + ppykkphdlkk+wkv+vLtavikhmsp+i++ir+++r sk+lqdkm+akes+++lsvl++ee+++++ s+++             +++++  +
  XP_021658581.1 262 S-PPYKKPHDLKKMWKVGVLTAVIKHMSPDIAKIRRHVRSSKCLQDKMTAKESAIWLSVLSREESLIQQPSSDNGtsgitempkGGCRGRKRHDI 355
                     9.9**********************************************************************4445677665533348999999 PP

                     XXXXXXXXXXXXXXX.XXXXXXXXXX.......................X CS
            EIN3 277 sceqkedvegkkeskikhvqavktta.......................g 303
                     s+++++dv+   +     ++++++ +                       +
  XP_021658581.1 356 SSDSDYDVDAAADVAGCVSSKDNRSTtamvaeplsivrndnphaiqdkeQ 405
                     9999*****66555544444444443456666666777665555554331 PP

Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    
MVLVRILDEC KSSPSPYPVE TDYIFWVRRW WTIVSLFLAP CLMFAHSLAD SSDIEVDDIR  60
CDNIPEKDVS DEEIETEELE RRMWKDQIKL KRIKERHKFE AQQAAEEQKL KHNSDQAQRK  120
KVSRAQDGIL KYMLKLMEVC KARGFVYGII PEKGKAVSGS SDNIRAWWKE KVKFDKNGPA  180
AIAKYEAECL ALGEANKNRN KKSQSILQDL QDATLGSLLS SLMQHCDPPQ RKYPLEKRVP  240
PPWWPTGNEE WWLKLGLPQG QSPPYKKPHD LKKMWKVGVL TAVIKHMSPD IAKIRRHVRS  300
SKCLQDKMTA KESAIWLSVL SREESLIQQP SSDNGTSGIT EMPKGGCRGR KRHDISSDSD  360
YDVDAAADVA GCVSSKDNRS TTAMVAEPLS IVRNDNPHAI QDKEQGERQL TKKPRGESSN  420
ADQQSGPLLN KHSFAEECVP DMNTADLSAM EYQMNGSEQE SDTTTSLRPL QKRFESGPNL  480
PPSEFIYFSA IPAANVDSMG GMHVDGSSML LRVLKNSESH HGAAYDIYNP TVDYGPAHDA  540
QQSQMTLDAT HIRPQDDGGN VPARHTDGDE IIRGDFHRPF GSPPPLHSLS SEYGPLPSPY  600
HFEIEEFLLD DELIKCFGA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-174EIL family protein