PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_021646972.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Micrandreae; Hevea
Family HB-PHD
Protein Properties Length: 1001aa    MW: 110227 Da    PI: 4.9539
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_021646972.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox41.12.9e-13824867952
                     HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                     +  +++L ++F++n+yp+++++e LAk+l++t rqV+ WF N R
  XP_021646972.1 824 EAVTQRLYKCFKENQYPDRATKESLAKELDITFRQVSKWFENAR 867
                     567899************************************99 PP

2PHD37.17.1e-13466521151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+   + +++++lCdg C++ fH+ Cl ++l +e++p +   wlC+ C++k
  XP_021646972.1 466 FCAKCGSkdLTVDNDIILCDGaCDRGFHQFCLVPPLLKEDIPPDdeGWLCPGCDCK 521
                     699***965555********66*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1001 aa     Download sequence    
MFKAKRMGIS PSQVSCHTKS YSCPKQSTSE ETPEYGAECK HTEISEQKHQ IMSETVQTEP  60
GDTNTVVSQS GASEALQQSS DDAMKNSLTE NLEAPSEDAC KSSLTDKSLG PKPTAIDQKL  120
EFVSEDTCNG PSKEQYSLGS GIIQNHNALS TITVNENLQL LSEDAAKNSL TNDLELPHED  180
ARESSQVGKS PCSQQSMPEQ TLEFSSDSAC CEPSVERGKA CLDIVKGELL KISTPLSSCT  240
ATRHFEPPPA LVAKSSIICL GLPRVSEINV PATEKLRPSH DDMDKHSNLE QSETPSKDTV  300
SNSSRVGWRV KRTAKSRKKY ILRSLVRSDR VLQSRSQEKP KAPDFSANLA NVSSKKEKTR  360
QKKKKRQGMR IEADEYSKIR KHLRYLLNRM SYEQSLIAAY SAEGWKGLSL EKLKPEKELQ  420
RATSEIFRRK LKIRDLFQRI DSLCVEGKLP ESLFDSEGQI SSEDIFCAKC GSKDLTVDND  480
IILCDGACDR GFHQFCLVPP LLKEDIPPDD EGWLCPGCDC KVDCIELLND CQGTNISISD  540
SWEKVFPEAA TAGQNPDQNF GLPSDDSDDN DYDPDGPEID EKSQGDESSS DESDFTSVSD  600
ELEASPGDKQ NLGLPSDDSE DDDYDPDGPD LDENVKEESS SSDFTSDSDD LATSLHNKEL  660
SGEHENRVSI GPQGDIIREG SKHSGKKKQY SELLSILEPS PSQDGSAPIS GRRNVERLNY  720
KKLYDETYGN VSSDSSDDED FTDTVGPRKR RRSTEVAPAS VNGDASVTKT GKQDLEGTEY  780
APKSCLQSNC ENTSISPAKS QEGSSPSSFC GRTVKRSVYR RLGEAVTQRL YKCFKENQYP  840
DRATKESLAK ELDITFRQVS KWFENARWSF NHSSSMDALV RKTSEKDSPL PKTNSKPLER  900
GHETVGGDAT SNGAQSEKSP KIGNATAESN MGDARDAKLG SQEGSKRKSK ILKSRKRKDI  960
SGQISSRTDS MTEETEKLPA NLPKAQETQA SGRVTRSKSV A
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1748752RKRRR
2748753RKRRRS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.18e-93HB-PHD family protein