PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_021645935.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Micrandreae; Hevea
Family EIL
Protein Properties Length: 589aa    MW: 65655.5 Da    PI: 5.8895
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_021645935.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN34332.9e-132383861323
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     eel+krmwkd+++l+r+ker+k    +++ a++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++raWW
  XP_021645935.1  38 EELEKRMWKDRIKLQRIKERQKFA--AQQ-AAEKQKPKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNIRAWW 129
                     8*****************999963..344.599************************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdq 190
                     kekv+fd+ngpaai+ky+a++l++ +++++  ++ ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWPtG+e+ww +lgl++ q
  XP_021645935.1 130 KEKVKFDKNGPAAIAKYEAECLAMVEADKN--RNGNSQSILQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVPPPWWPTGNEEWWLKLGLPQGQ 222
                     ***********************9988888..68999999******************************************************* PP

                     -.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.........XXXXXXXXXXX CS
            EIN3 191 gtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.........slrkqspkvtl 276
                     + ppykkphdlkk+wkv+vL+avikhmsp+i++ir+++rqsk+lqdkm+akes+++lsvl++ee+++++ s+++            + ++++  +
  XP_021645935.1 223 S-PPYKKPHDLKKMWKVGVLSAVIKHMSPDIAKIRRHVRQSKCLQDKMTAKESAIWLSVLSREESLIQQPSSDNGtsgitetpqGGHGEKKRPAI 316
                     9.9**********************************************************************4445676665433338889999 PP

                     XXXXXXXXXXXXXXX.XXXXXXXXXX.......................XXXXXXXXXXXXXXXXXXXXX CS
            EIN3 277 sceqkedvegkkeskikhvqavktta.......................gfpvvrkrkkkpsesakvssk 323
                     s+++++dv+ +++   + ++++++++                       + + + +rk+ +++s+ + ++
  XP_021645935.1 317 SSDSDYDVDATDDGIGSVSSKDNRRNtameveppssvqndnlqavedkdQGEKQPRRKRLRGKSSHADQQ 386
                     99*******7777777777777777778888888888888777677666566666666555555555544 PP

Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    
MGELEEIGAD ISSDIEVDDI RCDNIAEKDV SDEEIEAEEL EKRMWKDRIK LQRIKERQKF  60
AAQQAAEKQK PKQTSDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVKFDKNGP AAIAKYEAEC LAMVEADKNR NGNSQSILQD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKGV PPPWWPTGNE EWWLKLGLPQ GQSPPYKKPH DLKKMWKVGV  240
LSAVIKHMSP DIAKIRRHVR QSKCLQDKMT AKESAIWLSV LSREESLIQQ PSSDNGTSGI  300
TETPQGGHGE KKRPAISSDS DYDVDATDDG IGSVSSKDNR RNTAMEVEPP SSVQNDNLQA  360
VEDKDQGEKQ PRRKRLRGKS SHADQQSGPS LSKRSFAEEP INTVPDINTT DLSAVKYQIN  420
GTEQENDTTT GLRPWKKGLE SGSSLPPSEF NYFPAVPPAN VDSMGSMHAD GSSMFFSDLQ  480
NSGLHHGSAY DIYNPSVDYG PTHDAQRSHV TMDAPQIRSQ DYGGHISALH KDGNEITVGE  540
LHHLIKDRPF GSPPPLHSLS LEFGGLPSPY NFEIDEFLLD DELIQCFGA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.10.0EIL family protein