PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022763463.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Helicteroideae; Durio
Family HB-PHD
Protein Properties Length: 935aa    MW: 103405 Da    PI: 5.3215
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022763463.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.12.3e-118599001152
                     HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++L + F++++yp+++++e LAk+l++t  qV+ WF N R
  XP_022763463.1 859 VKQRLYKSFKESQYPDRATKESLAKELEITFMQVSKWFDNAR 900
                     6789************************************99 PP

2PHD40.94.8e-14487542151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+    ++++++lCdg C++ fH++Cl+++l +e++p +   wlC+eC++k
  XP_022763463.1 487 FCAKCGSkdLSANNDIILCDGaCDRGFHQYCLQPPLLKEDIPPDdeGWLCPECDCK 542
                     699***977677********66*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 935 aa     Download sequence    
MGISPSQAKS KKGNHFCPEE STSEQAHEFR SEYLLSELSE NKHQCGYAIT QNESAEIATV  60
ESRSSIREPS SEYVAKNSSP EYLGLLPKGV TNHNNTDKSF CPQETVSGKI HEYGFGYVHK  120
ETSENKIQSG SEIVHNKHEA SCTLVCGLPA KHLQPFSEDF SQNAITKSLG LLPEDSSKYT  180
QTDKLSCPQL GSAEPTVSFG SENICKVLSE PPEQGRQLDS ESLPNGIEKS TTAVSVNVFN  240
QALQLNPEDT NKGNCGKHLQ SPSEGVSNVI QTSKSSLVDP LALPQEFALE NPSIQQPRLH  300
CENMANNSGA EQHETTPKNL PNNSGRHRDG KTSKMIKKKY MLRSLTSNDR ILRSKSQEKS  360
KASESSNSLA DVGSSKQQKR RKRKRKRREK GEVVDEYSRI RAHLRYLLNR INYERSLIAA  420
YSTEGWKGLS LEKLKPEKEL QRATSEILRR KLKIRDLFQR IDSLCAEGRL PESLFDSEGQ  480
IDSEDIFCAK CGSKDLSANN DIILCDGACD RGFHQYCLQP PLLKEDIPPD DEGWLCPECD  540
CKVDCIELVN ESQGTSFSLT DNWEKVFPEA AVASGGQKQD PNFGLPSDDS DDNDYNPDSS  600
ETDEKDQENE LSFDESDFTS TSEELEVPAN VDPYLGLPSD DSEDDDYDPD GRDHDNVAKP  660
GSSSSDFTSD SEGLGAMLEY DSSSQKGEGP MSNSASKDSK GRKPKLGGKE SLNDELLSIM  720
ESATGLYGAV VSKKRSIERM DYKRLYDETY GNVPSSSSDD EDWSDTTAPR KRMKCTAEAA  780
TATAPANGNA SLSRSVSISD GLNPNPEETE HKPRRRTRQK SNFKGTDLSP AEFKGGASAS  840
GSSGKKAGSS TYRRLGEAVK QRLYKSFKES QYPDRATKES LAKELEITFM QVSKWFDNAR  900
WSFNNSSSIH ETAAKKVSKN DITLARPKKN RQIGI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1379385KRRKRKR
2379387KRRKRKRKR
3380386KRRKRKR
4380388KRRKRKRKR
5380385RRKRKR
6380386RRKRKRK
7380389RRKRKRKRRE
8380390RRKRKRKRREK
9381387KRRKRKR
10381386RKRKRK
11381390RRKRKRKRRE
12381391RRKRKRKRREK
13382388KRRKRKR
14383388RKRKRK
15383393RRKRKRKRREK
16385395RRKRKRKRREK
17815821RRTRQKS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.12e-91HB-PHD family protein