PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022763462.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Helicteroideae; Durio
Family HB-PHD
Protein Properties Length: 941aa    MW: 104177 Da    PI: 5.378
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022763462.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.12.3e-118659061152
                     HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++L + F++++yp+++++e LAk+l++t  qV+ WF N R
  XP_022763462.1 865 VKQRLYKSFKESQYPDRATKESLAKELEITFMQVSKWFDNAR 906
                     6789************************************99 PP

2PHD40.94.8e-14493548151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+    ++++++lCdg C++ fH++Cl+++l +e++p +   wlC+eC++k
  XP_022763462.1 493 FCAKCGSkdLSANNDIILCDGaCDRGFHQYCLQPPLLKEDIPPDdeGWLCPECDCK 548
                     699***977677********66*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 941 aa     Download sequence    
MFKVEHMGIS PSQAKSKKGN HFCPEESTSE QAHEFRSEYL LSELSENKHQ CGYAITQNES  60
AEIATVESRS SIREPSSEYV AKNSSPEYLG LLPKGVTNHN NTDKSFCPQE TVSGKIHEYG  120
FGYVHKETSE NKIQSGSEIV HNKHEASCTL VCGLPAKHLQ PFSEDFSQNA ITKSLGLLPE  180
DSSKYTQTDK LSCPQLGSAE PTVSFGSENI CKVLSEPPEQ GRQLDSESLP NGIEKSTTAV  240
SVNVFNQALQ LNPEDTNKGN CGKHLQSPSE GVSNVIQTSK SSLVDPLALP QEFALENPSI  300
QQPRLHCENM ANNSGAEQHE TTPKNLPNNS GRHRDGKTSK MIKKKYMLRS LTSNDRILRS  360
KSQEKSKASE SSNSLADVGS SKQQKRRKRK RKRREKGEVV DEYSRIRAHL RYLLNRINYE  420
RSLIAAYSTE GWKGLSLEKL KPEKELQRAT SEILRRKLKI RDLFQRIDSL CAEGRLPESL  480
FDSEGQIDSE DIFCAKCGSK DLSANNDIIL CDGACDRGFH QYCLQPPLLK EDIPPDDEGW  540
LCPECDCKVD CIELVNESQG TSFSLTDNWE KVFPEAAVAS GGQKQDPNFG LPSDDSDDND  600
YNPDSSETDE KDQENELSFD ESDFTSTSEE LEVPANVDPY LGLPSDDSED DDYDPDGRDH  660
DNVAKPGSSS SDFTSDSEGL GAMLEYDSSS QKGEGPMSNS ASKDSKGRKP KLGGKESLND  720
ELLSIMESAT GLYGAVVSKK RSIERMDYKR LYDETYGNVP SSSSDDEDWS DTTAPRKRMK  780
CTAEAATATA PANGNASLSR SVSISDGLNP NPEETEHKPR RRTRQKSNFK GTDLSPAEFK  840
GGASASGSSG KKAGSSTYRR LGEAVKQRLY KSFKESQYPD RATKESLAKE LEITFMQVSK  900
WFDNARWSFN NSSSIHETAA KKVSKNDITL ARPKKNRQIG I
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1385391KRRKRKR
2385393KRRKRKRKR
3386392KRRKRKR
4386394KRRKRKRKR
5386391RRKRKR
6386392RRKRKRK
7386395RRKRKRKRRE
8386396RRKRKRKRREK
9387393KRRKRKR
10387392RKRKRK
11387396RRKRKRKRRE
12387397RRKRKRKRREK
13388394KRRKRKR
14389394RKRKRK
15389399RRKRKRKRREK
16391401RRKRKRKRREK
17821827RRTRQKS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.12e-91HB-PHD family protein