PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022745531.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Helicteroideae; Durio
Family HB-PHD
Protein Properties Length: 940aa    MW: 104200 Da    PI: 5.2778
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022745531.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.34.6e-128578981152
                     HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++L + F++n+yp+++++e LAk+l++t +qV+ WF N R
  XP_022745531.1 857 VKQRLHSSFKENQYPDRATKESLAKELEMTFQQVSKWFENAR 898
                     6789************************************99 PP

2PHD34.54.5e-12486541151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+    ++++++lCdg C+  fH++Cl+++l +e++p +   wlC++C++k
  XP_022745531.1 486 FCAKCGSkdLSSNNDIILCDGaCDCGFHQYCLQPPLLKEDIPPDheGWLCPRCDCK 541
                     699***977667********66*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 940 aa     Download sequence    
MGVSPSRAKS KKENHCCPEE STSQQAHEFG SEYLHSELSE NKHRCGCAVT QNESAEIATC  60
VSSSAIHEPS SEYVAKNSSP EHLGLLPKGA SGHDHTDKSF YPQETVSGKT HKYCSQYVNK  120
ETSENKNQPS SEIVQNELEE ACTFVCGLPA KHLQPFSEDL SKNAITEGLG LPPDDSSKCN  180
QTDKLSCPQL DSSEPTVDFG SGNMRKKLCE PLEQRQELDS KGLPNGIEKS TTAVSSNVFN  240
QILQLNPEDM NKSHCSRHLQ SPPEGASSVI QTSKSSPVEP LRLLQEFAAG NPSIQQPSFH  300
IEDMAKNSGA EQHEIMPKNL LKNSGRCRDG KTSKRMKKKY MLRSLTSSDR ILRSKSQDKP  360
KATESSNILA DVGSSEQQKR RKRKKRKAKR EVADEYSRIR AHLRYLLNRM NYEQSLIAVY  420
SAEGWKGLSL EKLKPEKELQ RATSEILRLK LKIRDLFQRI DSLCAEGRLP ESLFDSEGQI  480
DSEDIFCAKC GSKDLSSNND IILCDGACDC GFHQYCLQPP LLKEDIPPDH EGWLCPRCDC  540
KVDCIELVNE SQGTSFSLTD SWEKVFPEAA VAAGGQNQDP NFGLPSDDSD DNDYNPDSSE  600
TDEKDWGDES SSDESDFTST SEELEAPAKV NPYLELRSDD SEDDDYDPNG PDHDNAVKPE  660
SSSSDFTSDS EDLGAMLEDN ISSQKEEGAV FINASRDSKR QKPKLGGRES LNDELLSVME  720
SASEQDGAAA SKKRSIERLD YKRLYDETYG SVSSSSSDDD YWNDATALRK RKKCAAEAAS  780
AAAANGNVSV SRSVSVSDGL KLYPEGTEHK PRRKTRQKSN LKDTDLSPAE LQVGTSVSGS  840
SGKKVGSSTY RRLGEAVKQR LHSSFKENQY PDRATKESLA KELEMTFQQV SKWFENARWS  900
FNNSPSINET TAKKVSENDI TSARPKKNCK MVTEKDKSKC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1377385QQKRRKRKK
2378387QKRRKRKKRK
3379385KRRKRKK
4379387KRRKRKKRK
5379390KRRKRKKRKAKR
6380386KRRKRKK
7381387KRRKRKK
8381385RKRKK
9382390KRRKRKKRK
10769773RKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-88HB-PHD family protein