PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022745514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Helicteroideae; Durio
Family HB-PHD
Protein Properties Length: 946aa    MW: 104938 Da    PI: 5.3288
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022745514.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.34.7e-128639041152
                     HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++L + F++n+yp+++++e LAk+l++t +qV+ WF N R
  XP_022745514.1 863 VKQRLHSSFKENQYPDRATKESLAKELEMTFQQVSKWFENAR 904
                     6789************************************99 PP

2PHD34.54.6e-12492547151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+    ++++++lCdg C+  fH++Cl+++l +e++p +   wlC++C++k
  XP_022745514.1 492 FCAKCGSkdLSSNNDIILCDGaCDCGFHQYCLQPPLLKEDIPPDheGWLCPRCDCK 547
                     699***977667********66*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 946 aa     Download sequence    
MIKVEHMGVS PSRAKSKKEN HCCPEESTSQ QAHEFGSEYL HSELSENKHR CGCAVTQNES  60
AEIATCVSSS AIHEPSSEYV AKNSSPEHLG LLPKGASGHD HTDKSFYPQE TVSGKTHKYC  120
SQYVNKETSE NKNQPSSEIV QNELEEACTF VCGLPAKHLQ PFSEDLSKNA ITEGLGLPPD  180
DSSKCNQTDK LSCPQLDSSE PTVDFGSGNM RKKLCEPLEQ RQELDSKGLP NGIEKSTTAV  240
SSNVFNQILQ LNPEDMNKSH CSRHLQSPPE GASSVIQTSK SSPVEPLRLL QEFAAGNPSI  300
QQPSFHIEDM AKNSGAEQHE IMPKNLLKNS GRCRDGKTSK RMKKKYMLRS LTSSDRILRS  360
KSQDKPKATE SSNILADVGS SEQQKRRKRK KRKAKREVAD EYSRIRAHLR YLLNRMNYEQ  420
SLIAVYSAEG WKGLSLEKLK PEKELQRATS EILRLKLKIR DLFQRIDSLC AEGRLPESLF  480
DSEGQIDSED IFCAKCGSKD LSSNNDIILC DGACDCGFHQ YCLQPPLLKE DIPPDHEGWL  540
CPRCDCKVDC IELVNESQGT SFSLTDSWEK VFPEAAVAAG GQNQDPNFGL PSDDSDDNDY  600
NPDSSETDEK DWGDESSSDE SDFTSTSEEL EAPAKVNPYL ELRSDDSEDD DYDPNGPDHD  660
NAVKPESSSS DFTSDSEDLG AMLEDNISSQ KEEGAVFINA SRDSKRQKPK LGGRESLNDE  720
LLSVMESASE QDGAAASKKR SIERLDYKRL YDETYGSVSS SSSDDDYWND ATALRKRKKC  780
AAEAASAAAA NGNVSVSRSV SVSDGLKLYP EGTEHKPRRK TRQKSNLKDT DLSPAELQVG  840
TSVSGSSGKK VGSSTYRRLG EAVKQRLHSS FKENQYPDRA TKESLAKELE MTFQQVSKWF  900
ENARWSFNNS PSINETTAKK VSENDITSAR PKKNCKMVTE KDKSKC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1383391QQKRRKRKK
2384393QKRRKRKKRK
3385391KRRKRKK
4385393KRRKRKKRK
5385396KRRKRKKRKAKR
6386392KRRKRKK
7387393KRRKRKK
8387391RKRKK
9388396KRRKRKKRK
10775779RKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-88HB-PHD family protein