PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022745506.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Helicteroideae; Durio
Family HB-PHD
Protein Properties Length: 979aa    MW: 108514 Da    PI: 5.3858
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022745506.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.24.8e-128969371152
                     HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++L + F++n+yp+++++e LAk+l++t +qV+ WF N R
  XP_022745506.1 896 VKQRLHSSFKENQYPDRATKESLAKELEMTFQQVSKWFENAR 937
                     6789************************************99 PP

2PHD34.54.7e-12526581151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+    ++++++lCdg C+  fH++Cl+++l +e++p +   wlC++C++k
  XP_022745506.1 526 FCAKCGSkdLSSNNDIILCDGaCDCGFHQYCLQPPLLKEDIPPDheGWLCPRCDCK 581
                     699***977667********66*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 979 aa     Download sequence    
MYVHSSSRIA AEKSPSLSLS VCLLKTRDSI LLTDMIKVEH MGVSPSRAKS KKENHCCPEE  60
STSQQAHEFG SEYLHSELSE NKHRCGCAVT QNESAEIATC VSSSAIHEPS SEYVAKNSSP  120
EHLGLLPKGA SGHDHTDKSF YPQETVSGKT HKYCSQYVNK ETSENKNQPS SEIVQNELEE  180
ACTFVCGLPA KHLQPFSEDL SKNAITEGLG LPPDDSSKCN QTDKLSCPQL DSSEPTVDFG  240
SGNMRKKLCE PLEQRQELDS KGLPNGIEKS TTAVSSNVFN QILQLNPEDM NKSHCSRHLQ  300
SPPEGASSVI QTSKSSPVEP LRLLQEFAAG NPSIQQPSFH IEDMAKNSGA EQHEIMPKNL  360
LKNSGRCRDG KTSKRMKKKY MLRSLTSSDR ILRSKSQDKP KATESSNILA DVGSSEQQKR  420
RKRKKRKAKR EVADEYSRIR AHLRYLLNRM NYEQSLIAVY SAEGWKGLSL EKLKPEKELQ  480
RATSEILRLK LKIRDLFQRI DSLCAEGRLP ESLFDSEGQI DSEDIFCAKC GSKDLSSNND  540
IILCDGACDC GFHQYCLQPP LLKEDIPPDH EGWLCPRCDC KVDCIELVNE SQGTSFSLTD  600
SWEVFPEAAV AAGGQNQDPN FGLPSDDSDD NDYNPDSSET DEKDWGDESS SDESDFTSTS  660
EELEAPAKVN PYLELRSDDS EDDDYDPNGP DHDNAVKPES SSSDFTSDSE DLGAMLEDNI  720
SSQKEEGAVF INASRDSKRQ KPKLGGRESL NDELLSVMES ASEQDGAAAS KKRSIERLDY  780
KRLYDETYGS VSSSSSDDDY WNDATALRKR KKCAAEAASA AAANGNVSVS RSVSVSDGLK  840
LYPEGTEHKP RRKTRQKSNL KDTDLSPAEL QVGTSVSGSS GKKVGSSTYR RLGEAVKQRL  900
HSSFKENQYP DRATKESLAK ELEMTFQQVS KWFENARWSF NNSPSINETT AKKVSENDIT  960
SARPKKNCKM VTEKDKSKC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1417425QQKRRKRKK
2418427QKRRKRKKRK
3419425KRRKRKK
4419427KRRKRKKRK
5419430KRRKRKKRKAKR
6420426KRRKRKK
7421427KRRKRKK
8421425RKRKK
9422430KRRKRKKRK
10808812RKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.14e-86HB-PHD family protein