PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022745502.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Helicteroideae; Durio
Family HB-PHD
Protein Properties Length: 980aa    MW: 108642 Da    PI: 5.4437
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022745502.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.24.9e-128979381152
                     HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++L + F++n+yp+++++e LAk+l++t +qV+ WF N R
  XP_022745502.1 897 VKQRLHSSFKENQYPDRATKESLAKELEMTFQQVSKWFENAR 938
                     6789************************************99 PP

2PHD34.54.8e-12526581151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+    ++++++lCdg C+  fH++Cl+++l +e++p +   wlC++C++k
  XP_022745502.1 526 FCAKCGSkdLSSNNDIILCDGaCDCGFHQYCLQPPLLKEDIPPDheGWLCPRCDCK 581
                     699***977667********66*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 980 aa     Download sequence    
MYVHSSSRIA AEKSPSLSLS VCLLKTRDSI LLTDMIKVEH MGVSPSRAKS KKENHCCPEE  60
STSQQAHEFG SEYLHSELSE NKHRCGCAVT QNESAEIATC VSSSAIHEPS SEYVAKNSSP  120
EHLGLLPKGA SGHDHTDKSF YPQETVSGKT HKYCSQYVNK ETSENKNQPS SEIVQNELEE  180
ACTFVCGLPA KHLQPFSEDL SKNAITEGLG LPPDDSSKCN QTDKLSCPQL DSSEPTVDFG  240
SGNMRKKLCE PLEQRQELDS KGLPNGIEKS TTAVSSNVFN QILQLNPEDM NKSHCSRHLQ  300
SPPEGASSVI QTSKSSPVEP LRLLQEFAAG NPSIQQPSFH IEDMAKNSGA EQHEIMPKNL  360
LKNSGRCRDG KTSKRMKKKY MLRSLTSSDR ILRSKSQDKP KATESSNILA DVGSSEQQKR  420
RKRKKRKAKR EVADEYSRIR AHLRYLLNRM NYEQSLIAVY SAEGWKGLSL EKLKPEKELQ  480
RATSEILRLK LKIRDLFQRI DSLCAEGRLP ESLFDSEGQI DSEDIFCAKC GSKDLSSNND  540
IILCDGACDC GFHQYCLQPP LLKEDIPPDH EGWLCPRCDC KVDCIELVNE SQGTSFSLTD  600
SWEKVFPEAA VAAGGQNQDP NFGLPSDDSD DNDYNPDSSE TDEKDWGDES SSDESDFTST  660
SEELEAPAKV NPYLELRSDD SEDDDYDPNG PDHDNAVKPE SSSSDFTSDS EDLGAMLEDN  720
ISSQKEEGAV FINASRDSKR QKPKLGGRES LNDELLSVME SASEQDGAAA SKKRSIERLD  780
YKRLYDETYG SVSSSSSDDD YWNDATALRK RKKCAAEAAS AAAANGNVSV SRSVSVSDGL  840
KLYPEGTEHK PRRKTRQKSN LKDTDLSPAE LQVGTSVSGS SGKKVGSSTY RRLGEAVKQR  900
LHSSFKENQY PDRATKESLA KELEMTFQQV SKWFENARWS FNNSPSINET TAKKVSENDI  960
TSARPKKNCK MVTEKDKSKC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1417425QQKRRKRKK
2418427QKRRKRKKRK
3419425KRRKRKK
4419427KRRKRKKRK
5419430KRRKRKKRKAKR
6420426KRRKRKK
7421427KRRKRKK
8421425RKRKK
9422430KRRKRKKRK
10809813RKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.12e-88HB-PHD family protein