PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022731937.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Helicteroideae; Durio
Family HB-PHD
Protein Properties Length: 695aa    MW: 78040.7 Da    PI: 9.4014
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022731937.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.81.1e-10470514953
                     HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     +  +e L ++F++n  ps+  +e L+k+lgL+ ++V  WF+N R+
  XP_022731937.1 470 PAAVEKLRQVFAENELPSRVIKENLSKELGLEPEKVNKWFKNARY 514
                     567899*************************************97 PP

2PHD35.42.4e-12207262151
                     SBTTTSSTCT..TSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgksde..egelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C+  d+  ++++vlCd +C+ +fH+kCl+++l++e++p g   w+C+ C++k
  XP_022731937.1 207 FCAKCKLRDAfpDNDIVLCDgTCNCAFHQKCLDPPLDTENIPPGdqGWFCKFCECK 262
                     699999944455********56********************9999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 695 aa     Download sequence    
MRGSGKKLID YESAKPSSSK REAGSKPIAA LKLKKRSKIS HGRVRKPKHH VKKVGSTLLK  60
RKVTASISKR TASDVSSSRK VGGETNKKVS SKKLDPSKLG GKNASFGSLE ENGKKDNGDV  120
GIKKLSKKKK KGQKDKVELD EASRLQGRTS REKIRPEKEL QRAKKQILKC KLGIREAIRQ  180
LDSLSSVGSI EGSVIAPDGS VYHEHIFCAK CKLRDAFPDN DIVLCDGTCN CAFHQKCLDP  240
PLDTENIPPG DQGWFCKFCE CKMEIIEAMN AHIGTNFSVD SHWQDIFKDE AAFPDDAIAS  300
LNPEEDWPSD DSEDDDYDPD RRENSCRIGG TATDGDESED TDSSISLSWS VDGEDFSGSG  360
RCENHDSGAD SSETSDGEII CGRRRRRAVD YKKLYDEMFG KDAPTFEQVS EDEDWGPGKR  420
KRREKESDAA STLMTLYESE TKFINADATE MIRQLPSDLK SRRPFFRIPP AAVEKLRQVF  480
AENELPSRVI KENLSKELGL EPEKVNKWFK NARYLALKSR KVEGADHLQS SSPRVSKEPG  540
MEAPERKDPD IMALEDMLEP TLLHTPKILK KKVRKSPNSK LLDTSLERSP HNGLSVVSPT  600
NSNKVGKELS DDLILKKLLN VKKKREKKRV SIIVGGGLQE FELEMERLCR AKVRLENMKQ  660
TLLRLETSKA RKLNKKQLHE ESFIYIPIAE LKEKV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1420425RKRREK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-140HB-PHD family protein