PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022731936.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Helicteroideae; Durio
Family HB-PHD
Protein Properties Length: 720aa    MW: 80950.1 Da    PI: 9.4388
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022731936.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.91.1e-10495539953
                     HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     +  +e L ++F++n  ps+  +e L+k+lgL+ ++V  WF+N R+
  XP_022731936.1 495 PAAVEKLRQVFAENELPSRVIKENLSKELGLEPEKVNKWFKNARY 539
                     667899*************************************97 PP

2PHD35.42.5e-12232287151
                     SBTTTSSTCT..TSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgksde..egelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C+  d+  ++++vlCd +C+ +fH+kCl+++l++e++p g   w+C+ C++k
  XP_022731936.1 232 FCAKCKLRDAfpDNDIVLCDgTCNCAFHQKCLDPPLDTENIPPGdqGWFCKFCECK 287
                     699999944455********56********************9999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 720 aa     Download sequence    
MRGSGKKLID YESAKPSSSK REAGSKPIAA LKLKKRSKIS HGRVRKPKHH VKKVGSTLLK  60
RKVTASISKR TASDVSSSRK VGGETNKKVS SKKLDPSKLG GKNASFGSLE ENGKKDNGDV  120
GIKKLSKKKK KGQKDKVELD EASRLQGRTR YLLIKMKLEQ SLIDAYSGEG WKGQSREKIR  180
PEKELQRAKK QILKCKLGIR EAIRQLDSLS SVGSIEGSVI APDGSVYHEH IFCAKCKLRD  240
AFPDNDIVLC DGTCNCAFHQ KCLDPPLDTE NIPPGDQGWF CKFCECKMEI IEAMNAHIGT  300
NFSVDSHWQD IFKDEAAFPD DAIASLNPEE DWPSDDSEDD DYDPDRRENS CRIGGTATDG  360
DESEDTDSSI SLSWSVDGED FSGSGRCENH DSGADSSETS DGEIICGRRR RRAVDYKKLY  420
DEMFGKDAPT FEQVSEDEDW GPGKRKRREK ESDAASTLMT LYESETKFIN ADATEMIRQL  480
PSDLKSRRPF FRIPPAAVEK LRQVFAENEL PSRVIKENLS KELGLEPEKV NKWFKNARYL  540
ALKSRKVEGA DHLQSSSPRV SKEPGMEAPE RKDPDIMALE DMLEPTLLHT PKILKKKVRK  600
SPNSKLLDTS LERSPHNGLS VVSPTNSNKV GKELSDDLIL KKLLNVKKKR EKKRVSIIVG  660
GGLQEFELEM ERLCRAKVRL ENMKQTLLRL ETSKARKLNK KQLHEESFIY IPIAELKEKV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127157KKKKKGQKDKVELDEASRLQGRTRYLLIKMK
2128158KKKKKGQKDKVELDEASRLQGRTRYLLIKMK
3445450RKRREK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-163HB-PHD family protein