PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_028556281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 613aa    MW: 67692.8 Da    PI: 5.6389
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_028556281.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.1e-094044411954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  XP_028556281.1 404 FEHflHPYPNDSEKLMLARQTGLTRSQISNWFINARVR 441
                     665559******************************88 PP

2BELL107.96.3e-35267338172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e+qelq+k akLl +l+eVd+++kqy +++q+v +sF+a+ag g+akpYt+lAl++iSrhFr+L+dai +qi
  XP_028556281.1 267 EKQELQNKLAKLLAMLDEVDRKFKQYFNEMQIVDASFDAIAGSGAAKPYTALALQTISRHFRSLRDAIDSQI 338
                     689******************************************************************998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    
MATFYSNSSN QRDAMENIYL RDPAGSEPAV SGNMVHLNFP SVSSYSNTLA GTREKQANCI  60
GDNAYSSWRD GRNVMLFMQA HGRSLDGGDE LIRNSASDVD PQLGLQTPLG ILNEHNLSLQ  120
QSMSSGQGQG LSLSLGTQIP VPSFKYQPAS SVVSGLSSYH SNSGNGETYG NENSRSRILN  180
ANASPYGFTN TMSTVPNSKY IKAAQQLLDE FVNIQRALKK KADNTKSISA SGFPASKDNK  240
GASRSDGNPS EHQESSANSP SELSTSEKQE LQNKLAKLLA MLDEVDRKFK QYFNEMQIVD  300
ASFDAIAGSG AAKPYTALAL QTISRHFRSL RDAIDSQIRS SQKILGEQDG LSGKGCGISR  360
LRYIDQHMRQ QKTIQQLGVM PQHAWRPQRG LPENSVSILR AWLFEHFLHP YPNDSEKLML  420
ARQTGLTRSQ ISNWFINARV RLWKPMVEDI YKEEFGENEM DSNSSSENAT KYIDELCNNA  480
QEDQQSPSNE RCQTNPSNQL NLISETNTAA RVPSFQNEPM DQRPHDSSNI NPLLHDTICN  540
AEGSSRLMTY TMNELARYDN GGVSLTLGLQ HCDDNLPASD VQEEFLASRG EDVYSSAPSI  600
GFGPSQLLNY FVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-117TALE family protein