PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_028555711.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 582aa    MW: 64924.1 Da    PI: 5.8439
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_028555711.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.88.8e-095145521854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e++ LA k gLt +qV++WF N R +
  XP_028555711.1 514 MFQNflHPYPKDNEKQLLALKSGLTRSQVSNWFINARVR 552
                     5887779******************************88 PP

2BELL58.71.5e-19388455472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     ++  +k  L+++l++Vd+r+ q+v+q+q  +s+F+ ++  g  ++ +++Al +iS  +r+++ +i++qi
  XP_028555711.1 388 QNSTRKYELINMLQMVDQRFTQCVDQIQNAVSAFHSATATGC-HLPAQFALSTISSFYRAIRKKITGQI 455
                     67899************************************9.899*********************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    
MMENDFFNAS SSAADHSYMA AMDGFSSQMF SGSMFPSDVP DHGNCRQIMH TDSLYLTYQE  60
EGPNSELYAP NMSHITNASF NASIGNTNLR ENLMGTSLSA ASLADLLSTT TSLRDNHTTS  120
SFSLEDMKKV IPIESCISLN SSAKISVSSD FGPQDHTVFL ASQKGGGDSN GQRNYNMLNC  180
KLYDELSRNQ FPSTQTSSTV HPSYLVGSLE QGWISNRSTL SFDLSHGNEL SLSLGSSQPS  240
VFSLANGADQ CSEVSYSGMT QVMSRVGSSM DVNKMHNLPR DYQNSFTNRE KLSLCCGSSH  300
MPVHFSQMLS GSRYLLVIQE ILSELASYAT EDVEEVDDSL GDSVAEAKRS SSSCSIVNGF  360
TATGSNGLPF CSGENEQEQQ TDFQLQEQNS TRKYELINML QMVDQRFTQC VDQIQNAVSA  420
FHSATATGCH LPAQFALSTI SSFYRAIRKK ITGQIASFSQ ESSFEFMKEK ERSFETSFIQ  480
RQWALQQLKR TDQPSWRPQR GLPEKSVSVL RAWMFQNFLH PYPKDNEKQL LALKSGLTRS  540
QVSNWFINAR VRLWKPMIEE MYSEINRKNR AEEGSSSLHR NH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.13e-78TALE family protein