PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_028555066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 401aa    MW: 44578.9 Da    PI: 5.5794
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_028555066.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.81.5e-073273602154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++++L +++gL+ +q+ +WF N+R +
  XP_028555066.1 327 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 360
                     569*****************************87 PP

2ELK292.4e-10281302122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_028555066.1 281 ELKHELKNGYKEKIVDIREEIL 302
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    
MAYHNHLTQE ITLPAYADQH LVEDAGKSPT VAAAATARHL AGGPSWLNNP ILRQPHQFVD  60
GSFLHLQTAP APFRSADDEV PASSDSIIVA TAGDEETPAG SGEAVEGTWQ RARYKAEILA  120
HPLYEQLLSA HVACLRIATP VDQLPRIDAQ LAQSQQVVAK YSVMAGGQML AGEEKELDQF  180
MTHYVLLLCS FKEQLQQHVR VHAMEAVMAC WELEQSLQSL TGVSPGEGTG ATMSDDDDDD  240
DQADGETNFY DGSFDGSDSM GFGPLVPTES ERSLMERVRQ ELKHELKNGY KEKIVDIREE  300
ILRKRRAGKL PGDTTSTLKA WWQSHAKWPY PTEDDKARLV QETGLQLKQI NNWFINQRKR  360
NWHSNPSSST ALKSKRKRIA GDRNLKGLEG TQGKLLNWSE I
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1358378RKRNWHSNPSSSTALKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-164TALE family protein