PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_028554898.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 445aa    MW: 50271.6 Da    PI: 6.4635
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_028554898.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-083834201954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     F+   ++yps +e+  LA+++gL+ +q+++WF N R +
  XP_028554898.1 383 FNHflHPYPSDNEKLLLASQTGLKRNQISNWFINARVR 420
                     554458******************************88 PP

2BELL61.91.5e-202633171872
            BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     ++++  +qy +q+++++ sFea+ag g+a+ Yt+l +ka+S+hF +Lkd i+ +i
  XP_028554898.1 263 QLERHQQQYFHQMHALVDSFEAIAGTGAAAAYTTLTMKAMSKHFSNLKDTITTHI 317
                     6788889********************************************9987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    
MASYSSQPQE LCHCLQCDKK IQNDFLQSWM NEEAGKQESF LGLVHGHGNG NSLSLSLGSH  60
MESMNSYNYK KTHTLSNDIS SNSLVHEDVM VESSSSCAEH AKHECMTCDG DAASSGCGSR  120
SSDANYYDSI SIVSFVQNSR YLKPAQLLLD EVVFVNKNSD IELSSEEKMD RTDAVDVLSC  180
GRPQFTGEEM DSKKGNMKFL CLTKEKQDIE TRITKLVALL EEVFTSIRLN GEWRFIMTIT  240
HSLGKTNVDD VIYLFISFSI FIQLERHQQQ YFHQMHALVD SFEAIAGTGA AAAYTTLTMK  300
AMSKHFSNLK DTITTHITSA SKALSKDLSR NNGAPSLYTH SHSNYKHKKE ALQSIGMVRI  360
QQVSRPLRGL PEDSVAVLRA WLFNHFLHPY PSDNEKLLLA SQTGLKRNQI SNWFINARVR  420
LWKPMIEEMY REEFTEDQQD SNPSP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.13e-53TALE family protein