PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_028554854.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 339aa    MW: 37851.6 Da    PI: 6.525
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_028554854.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.7e-092653002055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++e+  L++++gL+++q+ +WF N+R ++
  XP_028554854.1 265 YKWPYPSETEKVALSESTGLDQKQINNWFINQRKRH 300
                     4679*****************************885 PP

2ELK30.58e-11220241122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +Ll+KYsgyL+sL+qE+s
  XP_028554854.1 220 ELKLHLLKKYSGYLSSLRQELS 241
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    
MEEFLHLGGS STRTPFTFSS LPAVGGPQQA SAASGSSFFY GARSQNPNPS TSTPKLEPGS  60
STYFSTDVES IKAKIISHPQ YPALLNAYMD CQKVGAPPEV VARLSTVARE LEARQLASPS  120
GCRRGTQADP ELDQFMEAYC NMLVKYKEEL TRPVQEAMDF LRKVESQLNS LTNGATVPFF  180
TSASLADEKC EGVVSSEEDQ DGSGAEAEVP EIDPRAEDKE LKLHLLKKYS GYLSSLRQEL  240
SKKKKKGKLP KDARQKLLNW WELHYKWPYP SETEKVALSE STGLDQKQIN NWFINQRKRH  300
WKPSEDMQFV VMDSFHPQNA AALYMGGQFL ADGNYRFGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-106TALE family protein