PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_028553386.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 468aa    MW: 52220.5 Da    PI: 8.9731
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_028553386.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.8e-082682982454
                     S--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  24 ypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     yps  ++  LA+++gL+ +qV++WF N R +
  XP_028553386.1 268 YPSDVDKHILARQTGLSRNQVTNWFINARVR 298
                     9****************************88 PP

2BELL1024.4e-33134202472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     elqk+ka Lls+leeVd +Yk+y+eq+ +v+ssFe +ag g+a++Y +lA+ka+SrhFr+L+d i+eq+
  XP_028553386.1 134 ELQKRKANLLSMLEEVDGKYKKYCEQMAAVASSFESAAGEGAATVYLALASKAMSRHFRSLRDGIVEQM 202
                     89****************************************************************995 PP

Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    
MDRELHGQPA AAMGYSGFSL GGNFRMQGYE SHDLYSLQAT SAVDFPSIVS SPQQNFFFND  60
GKFISAQTVV TGSQRLKLSK YVFAAQELLN EFCNLGGFIR SSKQKSQSRR LVGGGTASSA  120
SLRDHSLKSL HILELQKRKA NLLSMLEEVD GKYKKYCEQM AAVASSFESA AGEGAATVYL  180
ALASKAMSRH FRSLRDGIVE QMQATMNAIA ERDPIAARGI SRGETPRLKL IDQFCVRQQK  240
AFQQGGIFMD QPPWRPQRGL IYYLIILYPS DVDKHILARQ TGLSRNQVTN WFINARVRLW  300
KPMIEEIYLE ETKEDELANP TRPAQQDNRN PNPSFSTDPK EPAKLLTDPD SLNSIINADR  360
RDHSNQRSFH NYQNQVQRTE HFGVADFDFS SYSECSGQSY SGNGVSLTLG LQHHNGGSSR  420
HDGGGFSFSP ANNQQFSMID GEAQKPTYRS LMRGQLLQDL GGQRAGWA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.12e-72TALE family protein