PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_028552550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 403aa    MW: 46159.1 Da    PI: 6.1987
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_028552550.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.7e-093413781954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +e+  LA+++gLt +q+++WF N R +
  XP_028552550.1 341 FEHflHPYPSDNEKLFLASQTGLTRNQISNWFINARVR 378
                     564459******************************88 PP

2BELL65.98.2e-22223288772
            BELL   7 kkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     ++ +kL +l+ee++kr k y + +  ++ sFeav g gsa+ Yt+l ++a+S+hF +L++ i+++i
  XP_028552550.1 223 NRMNKLFTLQEELEKRQKIYFHRMDELVTSFEAVGGPGSAAAYTALTSRAMSKHFANLRESIINHI 288
                     6899***********************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    
MVPQELPKEP IGVSEMNNRQ SHPGGICYCS HWNSVDRGLV RPHSLPSSFQ PHDTQIRRSV  60
EPFSVRCKED DFSSFDHIQG HGLSLSLGPE LELEPNNVRP YDYNQAQMVE NVMRNKSLIE  120
LMCEPSCSCA ERLSDDGIIC DQDVDGSIYN SRCSNTKFDN MAPVMSVLQK SPYLKAAQQL  180
LDEAVCVCNF VPEPSSEKDA HRKNQIKENA HTVHLSREEQ EVNRMNKLFT LQEELEKRQK  240
IYFHRMDELV TSFEAVGGPG SAAAYTALTS RAMSKHFANL RESIINHIES SREAFSKDMP  300
KNLKPKRESL QHLGLIHVGQ IWRPLRGLPE DSVMVLRAWL FEHFLHPYPS DNEKLFLASQ  360
TGLTRNQISN WFINARVRLW KPMIEEMYRE EFAEDQGDSN SSP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.23e-65TALE family protein