PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020703541.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 454aa    MW: 51181.7 Da    PI: 8.2384
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020703541.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-092532901954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+  +++ LAk+ gLt +qV++WF N R +
  XP_020703541.1 253 FEHflHPYPTDVDKQMLAKQAGLTRNQVSNWFINARVR 290
                     664459******************************88 PP

2BELL95.16.1e-31126194472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     + q kka+L+s+++eV++rY+ y++q+q vi sFe+vagl +a+pY+slAl+ +S+hFrcLk+++++q+
  XP_020703541.1 126 DQQWKKARLISMIDEVCRRYRIYYQQVQNVITSFEMVAGLRTAAPYVSLALNSMSKHFRCLKNMMTNQL 194
                     5799*************************************************************9996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    
MSSSDDPFLL HHHNLLYHVP QHSRREKLRF QTDSSSLPNP MAHFTAGTGL LQIQPPQGSF  60
SLTLSPAAAL LPLGPFTGYA AVLNRSRFLD PARQLLEEVC EVAGGEPLAG DPPEVMSLDY  120
EVGPDDQQWK KARLISMIDE VCRRYRIYYQ QVQNVITSFE MVAGLRTAAP YVSLALNSMS  180
KHFRCLKNMM TNQLSLTNKD SGKEGFSRTE ISGFGMCLQQ DGNNLDSYRQ PHAWRPQRGL  240
PERAIAVLRA WLFEHFLHPY PTDVDKQMLA KQAGLTRNQV SNWFINARVR LWKPMVEEIH  300
NLEMRQQQKT VVPNNKNQIS HNKQASKPSS STATSSSTQP PQNSFIQRNQ NPPSSRSLNN  360
ELDYIAHHIE EPYKYAYNDF SSQDVGRNTG STVSLTLGLH QNSGVRLPEP LPLNVARRFG  420
LEDCNDAYVV GAFEGQDRRF GKDIGGHLLH DFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.18e-76TALE family protein