PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020702317.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 304aa    MW: 34607.9 Da    PI: 5.9711
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020702317.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-092272622055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  XP_020702317.1 227 NKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 262
                     5679*****************************885 PP

2ELK38.42.7e-13182203122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKhqLl+KYsgyLgsL+qE+s
  XP_020702317.1 182 ELKHQLLKKYSGYLGSLRQELS 203
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    
MDDFMFPSII TTQPSSSHLI KDEISFAGAC VPPPVSPADV KARIMAHPHY PNLVAAYAEC  60
HKLGAPPEVA ARLSTVTRDL ETRPGGGRSF PTADPELDQF MEAYYDILVK YKEELSRPFE  120
EAADFLRKAE SQLSSITDLS SMSFHFSTDH EKSGACSAEE DQFEVSLGET VLEGEQAAED  180
RELKHQLLKK YSGYLGSLRQ ELSKKKKKGK LPKEARQKLL SWWELHNKWP YPSESEKVAL  240
AESTGLDQKQ INNWFINQRK RHWKPSEEMQ FMVLDGYQQH QQQNTTFYLE GHFMGDGNLY  300
RIGS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-103TALE family protein