PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020701745.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 486aa    MW: 55124.8 Da    PI: 7.4036
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020701745.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.65e-092973341954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_020701745.1 297 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 334
                     554459******************************88 PP

2BELL103.81.2e-33159227472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     elq++kakL ++leeVd+rYk+y eq+++v+s Fe++ag g+a+ Y  lA ka+SrhFrcL+d i++qi
  XP_020701745.1 159 ELQRRKAKLFTMLEEVDRRYKKYSEQMKAVVSTFEEIAGGGAARTYSMLAWKAMSRHFRCLRDGISGQI 227
                     89*****************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    
MSQDSHYLHH HQHHYPFNNI SAINNHSSMN NFEPTAAGNH DPFTLNMPTP NLRGFVPETA  60
PIAWPGENSS MMRPIHTNQV QSLSLSLFNP PQPPSFQISS HHPFQIKSCK YLLPAQELLN  120
EFCSLGVGNN LKTKNSNKLQ DESSASWSQQ ALYAMEPLEL QRRKAKLFTM LEEVDRRYKK  180
YSEQMKAVVS TFEEIAGGGA ARTYSMLAWK AMSRHFRCLR DGISGQIKAI RKAMGEKDGG  240
ITSGLTRGET PRLKVIDQCL RQQKAFQHPS GTMESHPWRP QRGLPERSVS VLRAWLFEHF  300
LHPYPSDVDK HILARQTGLS RSQVSNWFIN ARVRLWKPMV EEMYLEELNE ETKICQSSHA  360
TSMQEGDSNN QHSSNPNLSS SSEPHFDQGR KSGMLGHLHH LDEPHSLTSI ISTVHTHNHP  420
NPNPNLNQNF DNLDVDHFDS YHGQELTLGL QHHEGDAMQF SVLVGEGQSI PYRNLMGAQL  480
LRDLTG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.15e-97TALE family protein