PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020700623.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 336aa    MW: 37294.8 Da    PI: 4.5944
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020700623.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.11.3e-072612942255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp+ +e+++L + +gL+++q+ +WF N+R ++
  XP_020700623.1 261 WPYPTDDEKAKLVEFTGLDQKQINNWFINQRKRH 294
                     58*****************************885 PP

2ELK27.66.6e-10214235122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK+ L rKYsgyL++L++EFs
  XP_020700623.1 214 ELKEFLFRKYSGYLCNLRTEFS 235
                     89*******************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    
MEDLYCIHPG IPRATIVGSG ELSVGCEGEI RFDGAEIAAD ESGFLEADLT DLIKARIASH  60
PRYSSLLSAY IECNKVGAPP EMATLLEDIA RERSTGRYCG SVGEVGEIGA DPELDEFMDS  120
YCRVLVRYKY ELSKPFDEAV SFLASIESQL SKLCNFSAAA TTSSSSTAFS TAVASTGGAL  180
TFDEAVGSSE EVPSYDDADA LENQVSSSRS PEIELKEFLF RKYSGYLCNL RTEFSKKKKK  240
GKLPREARLT LLDWWNSHYK WPYPTDDEKA KLVEFTGLDQ KQINNWFINQ RKRHWKPSED  300
LQCTIMEGLW GISSGTTLCF ETGSIRSFNL NNSSPC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.12e-79TALE family protein