PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020698520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 555aa    MW: 61176.2 Da    PI: 7.2317
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020698520.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093914232254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yp+ +++  LA+++gL+ +qV++WF N R +
  XP_020698520.1 391 HPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 423
                     89*****************************88 PP

2BELL114.65e-37243311472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e+++kkakLl ++eeV++rYkqy++q+q+v+ssFe vagl sa+pYt+lAlka+S+hFrcLk ai++q+
  XP_020698520.1 243 EVEQKKAKLLYMQEEVCRRYKQYHQQMQMVVSSFESVAGLSSATPYTTLALKAVSKHFRCLKSAISDQL 311
                     7899**************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    
MLPHVAQHIR REKLRVQPSY DPSTLPPQLD FPASDSSSFL NPFEPSSALW KTDWILHNCT  60
NPAELHLPSL PFSPYPLHEV VSSSGLDLSP SPALLPPPPP FDSGNELLLL PNYASANSGS  120
VWTARSHSDG QRLSLSLASN PPQEILADRW LPVQGISGGR QTAGPLGPFT GYAAILKSSR  180
FLKPAQQLLD EFCSVVTGAR VGKDYDSGSS VAASSSSFQS STDIVGVEGG GGCHSGEIQY  240
WPEVEQKKAK LLYMQEEVCR RYKQYHQQMQ MVVSSFESVA GLSSATPYTT LALKAVSKHF  300
RCLKSAISDQ LRHVCNVLGE ELMASSPSSS RNDNLTIPKL KYIDQTVRRQ KSGDGNLSFS  360
DNTHPIWRPQ RGLPERAVSV LRAWLFDHFL HPYPTDTDKH MLATQTGLSR NQVSNWFINA  420
RVRLWKPMVE EIHMLETKGM AGMDLNSSSK TMADKATIVQ RSEAQSSKHV LVSSSDEMPM  480
AKSSHCLEHW HEGKRSRIED CAMDAGLMSF AYQGGMDIGG LGAVSLTLGL RQGEGIQPEQ  540
QMRHFGHQML HDFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.19e-92TALE family protein