PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020698116.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 287aa    MW: 32106 Da    PI: 4.7403
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020698116.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-092282622155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp+++++  LA+ +gL+++q+ +WF N+R ++
  XP_020698116.1 228 KWPYPTEADKIALAEATGLDQKQINNWFINQRKRH 262
                     569*****************************885 PP

2ELK37.35.9e-13182203122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     +LK+ LlrKYsgyL+sLkqEFs
  XP_020698116.1 182 DLKEKLLRKYSGYLSSLKQEFS 203
                     69*******************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    
MDEMYGLQPD SAFAAAEDLH GLIAAAGYGA AAAAAAAEEE MKARIASHPR YPHLLEAYID  60
CQKVGAPPDI ASLLEDIRRE NAGGERVASS SVILGSDPEL DEFMEMYCDV LVKYRRDLER  120
PFDEATAFLN TMEVQLSDLC KPTCRPALGP YVSDEAVGSS DEELSGGEGE APESHLKGEE  180
RDLKEKLLRK YSGYLSSLKQ EFSKKKKKGK LPKEARQILF EWWTAHYKWP YPTEADKIAL  240
AEATGLDQKQ INNWFINQRK RHWKPADQNM HFSVMDSSST SSFFADD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-82TALE family protein