PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020697623.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 617aa    MW: 68637.2 Da    PI: 6.3299
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020697623.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-094104471954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+  L+k++gLt +qV++WF N R +
  XP_020697623.1 410 FEHflHPYPNDSEKLMLSKQTGLTRSQVSNWFINARVR 447
                     665559******************************88 PP

2BELL122.81.4e-39273344172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqelq+k +kL+ +l+eVd+rYkqy++q+q+v+ssF+a+ag g+akpYt+lAl++iSrhFr+L+dai +qi
  XP_020697623.1 273 ERQELQSKMTKLVAMLDEVDRRYKQYYHQMQIVVSSFDAIAGSGAAKPYTALALQTISRHFRSLRDAIGDQI 344
                     79*******************************************************************998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 617 aa     Download sequence    
MRKMATFYPS STNQRDVMGN LYLRDPTGHA MYPESAVNGN MVYLNISSGP YSETLAGSIQ  60
SEQNCIGFTD LVASQLGENA YNSWRDGRNE MLFLQANGES MAGDDSQMGL QSHLGILNEH  120
NLSLQHSNIS NVQGQGLSLS LGMQIPVPSF KYQPNQSDVA ILSSHQSSSG NGEAYRNDDS  180
RSRIQNINVP SYGLSNITSA IPNSKYLKTA QQLLDEVVNV QKALKKKTDC TQSFNTSGKQ  240
ACKDNDGESK SGGSPTNHPG STANSSSELS PSERQELQSK MTKLVAMLDE VDRRYKQYYH  300
QMQIVVSSFD AIAGSGAAKP YTALALQTIS RHFRSLRDAI GDQIRCTRKI LGELDGSTGK  360
GCGISRLRYI DQQIRQQRAI QQLGMMPQHA WRPQRGLPEN SVTILRAWLF EHFLHPYPND  420
SEKLMLSKQT GLTRSQVSNW FINARVRLWK PMVEDMYKEE FGEAEMDSNS SSDNATKFRD  480
EFHSTDTHED QPSSASERIQ AKLSNNESSP NIMAEINVAC ANPGFENELQ DQRQQNSPYI  540
NLLHNAIHHS RFISYPMTEL SRYANGVSLT LGLQHCDGNL QDSEDQQGFL PVRGEDIYNA  600
APLLGFGSSN LLHDYVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-118TALE family protein