PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020695101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 161aa    MW: 18869.2 Da    PI: 7.7919
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020695101.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.82.4e-10841192055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  XP_020695101.1  84 NKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 119
                     5679*****************************985 PP

2ELK39.61.1e-133960122
             ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                    ELKhqLl+KYsgyLgsL+qE+s
  XP_020695101.1 39 ELKHQLLKKYSGYLGSLRQELS 60
                    9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    
MHRTADHEKS GACSAEEDQF EVSLGETVLE GEQAAEDREL KHQLLKKYSG YLGSLRQELS  60
KKKKKGKLPK EARQKLLSWW ELHNKWPYPS ESEKVALAES TGLDQKQINN WFINQRKRHW  120
KPSEEMQFMV LDGYQQHQQQ NTTFYLEGHF MGDGNLYRIG S
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.18e-64TALE family protein