PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020693104.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 621aa    MW: 69549.6 Da    PI: 6.1794
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020693104.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-093894261954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+  LA+++gLt +qV++WF N R +
  XP_020693104.1 389 FEHflHPYPKDSEKLMLARQTGLTRSQVSNWFINARVR 426
                     664559******************************88 PP

2BELL121.73.1e-39254325172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e+qe q+k +kL+++++eVd++Ykqy++q+q+v+ssF+++ag g+akpYt+lAl++iSrhFrcL+dai+ qi
  XP_020693104.1 254 EKQEFQNKLTKLMEMVDEVDRKYKQYYHQMQIVMSSFDVIAGAGAAKPYTTLALQTISRHFRCLRDAISAQI 325
                     689*******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    
MTVFYSSSTN QDEIMPSLYP REPARATYTE IPFQGNMMYF HHSSSAPCTV NAQDSSEEAA  60
NLVANRFGEN MYDSWREGRN EMLLMQTVGG STNDDSHLSI LSGQNFPLSG STMQGQGLSL  120
SLGTQVSVPT FHYLPATADI SFSVPNQPTS LSDGSCKKSS MIKHVQVNSS HPSVPYLMSS  180
TLNLNYLKAT QELLDEVVNV RKVLIQKRGK NQNLGDSSGF TDCKEFDVGS KSNEVPSMPR  240
DDAASSTKEL SASEKQEFQN KLTKLMEMVD EVDRKYKQYY HQMQIVMSSF DVIAGAGAAK  300
PYTTLALQTI SRHFRCLRDA ISAQIQSTRK KLGEQDNGDS VRLSRLRYID QELRQRRVVQ  360
QYGILQPHAW RPQRGLPENS VSILRAWLFE HFLHPYPKDS EKLMLARQTG LTRSQVSNWF  420
INARVRLWKP MIEEMHKEEL GDIDMDSKSS PDRLQKIQED MRYTIGKDED PQSSDAENCR  480
LSHSNEPSKS NPIIDPDTSG SGVHFDHKPR DEKLAGEESS LLQTDISNPD DGSGRIMAYQ  540
MAELGQYGTG MVSLTLGLQH WSSNLPVSND QHSFMSVRGT DVYSSNSSPL EANVGSYVFE  600
NIGDRHHGCA GSLHFMQGFT P
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-116TALE family protein