PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020689904.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 300aa    MW: 34140.8 Da    PI: 6.4538
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020689904.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-072482812154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++++L +++gL+ +q+ +WF N+R +
  XP_020689904.1 248 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 281
                     469*****************************87 PP

2ELK22.62.5e-08202223122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  XP_020689904.1 202 ELKLELKQGFRSRIEDVREEIL 223
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    
MMQGDPHQDL GMHISTAAAV GECSSSVPPS AAAEEEHRRL LKAEISVHPF LEQLLSAHVG  60
CLRVATPIDH LPLIDAQLSQ SHHLLRSYAS LHRPLLSPQE KLDLDNFLYS LLLCSFKEQL  120
QQHVRVHAVE AVMACREIEQ SLHELTGITL DEGTGATMSD DEDDLQLDCS LDPAMDGHDL  180
MGFGPLLPSE TERSLMERVR QELKLELKQG FRSRIEDVRE EILRKRRAGK LPGDTTSVLK  240
QWWQQHSKWP YPTEDDKAKL VEETGLQLKQ INNWFINQRK RNWHNNAQSA TSCLKSKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279300RKRNWHNNAQSATSCLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-142TALE family protein