PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020689903.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 302aa    MW: 34400.1 Da    PI: 6.4538
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020689903.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-072502832154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++++L +++gL+ +q+ +WF N+R +
  XP_020689903.1 250 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 283
                     469*****************************87 PP

2ELK22.62.5e-08204225122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  XP_020689903.1 204 ELKLELKQGFRSRIEDVREEIL 225
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    
MMQGDPHQDL GMHISTAAAV GECSSSVPPS AAAEEEHRRL LKAEISVHPF LEQLLSAHVG  60
CLRVATPIDH LPLIDAQLSQ SHHLLRSYAS LHRPLLSPQE KLDLDNFLMQ YSLLLCSFKE  120
QLQQHVRVHA VEAVMACREI EQSLHELTGI TLDEGTGATM SDDEDDLQLD CSLDPAMDGH  180
DLMGFGPLLP SETERSLMER VRQELKLELK QGFRSRIEDV REEILRKRRA GKLPGDTTSV  240
LKQWWQQHSK WPYPTEDDKA KLVEETGLQL KQINNWFINQ RKRNWHNNAQ SATSCLKSKR  300
KR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1281302RKRNWHNNAQSATSCLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-151TALE family protein