PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020688159.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 358aa    MW: 40530.9 Da    PI: 9.9125
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020688159.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.29.1e-111621991954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ ++++ LAk++gLt +qV++WF N R +
  XP_020688159.1 162 FEHflHPYPTDTDKQMLAKQTGLTRNQVSNWFINARVR 199
                     554459******************************88 PP

2BELL721e-2343971872
            BELL 18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                    +V++rY+ y++q++tvi+sFe+vagl++a+pY+s+Alk +S++Fr+Lk+ i++++
  XP_020688159.1 43 QVYRRYRLYYQQVETVIASFETVAGLNTAAPYISFALKSMSKNFRSLKNIISNHL 97
                    79*************************************************9885 PP

Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    
MPLQQLTAAI LQSRFRPHVR RRPYSSIYVL STIIFVFFFS TFQVYRRYRL YYQQVETVIA  60
SFETVAGLNT AAPYISFALK SMSKNFRSLK NIISNHLNNL GKINVKEGLG KGEFTGFGLT  120
ATGDHSCTQR RNSSLSFGQT QVWRPQRGLP ERAVAVLRAW LFEHFLHPYP TDTDKQMLAK  180
QTGLTRNQVS NWFINARVRL WKPMVEEIHN LEMHQLQKTV GTDHNVQNPT FQASQPSSSS  240
AATSSSNRAP VNNFMQRTSQ NQSYRPANIE QLPHIEEPYK FIFDNDFACH SQPVGVEIGG  300
NSVVSLTLGL PEPLSVNVAR RFGLEECSNA YVLGGFEGGQ ERHYGKEIGA HLLHDFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.15e-58TALE family protein