PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020687480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 500aa    MW: 56861 Da    PI: 5.3407
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020687480.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.81.8e-084224601854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e++ LA + gLt +qV++WF N R +
  XP_020687480.1 422 MFQNflHPYPKDNEKQLLALRSGLTRNQVSNWFINARVR 460
                     5887779******************************88 PP

2BELL56.47.4e-19294363272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +q+ ++ k+ L+++l +Vd+r++q+ +q+q v+ssF+a a  gs ++ +++Al +iS  +++++  ia+ i
  XP_020687480.1 294 KQQSNSSKSELINMLAMVDQRFNQFLDQIQNVVSSFNAKAASGS-NLPAKFALTTISNFYKNIRSTIADEI 363
                     56778899***********************************9.899*******************9876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    
MMENGVFDPV SSLIDHSYMA MDGFSTSMLS GSHIMSGVSD HGRFRQILHT NPLYLTYKEE  60
VLRNMNHNGN SSIQNTNFRE NNVHSGFLTS PKDDNSDFHL NCKEIYDEFS ANQFSSTLTS  120
SSFHPSYLVG SSEQGTLSFD NELSLRLGSS HPSVLNLPNV NDLYIDESYS DKTQVMSSSG  180
SGGGSKDINK MYNFTNENYL FENVQKFPNS GSSRVPLDLR YLHAIQEILA ELTSNAVEDV  240
EEIDDSLADL VSEANMSSSS GSTVKGFRET GFNVLPFCSV ENEYEQEMDC QPQKQQSNSS  300
KSELINMLAM VDQRFNQFLD QIQNVVSSFN AKAASGSNLP AKFALTTISN FYKNIRSTIA  360
DEIVSNGREP SSECMQEEER NFESSFIQRQ WDLQQLKQRD QPSWRPQRGL PEKSVSVLRA  420
WMFQNFLHPY PKDNEKQLLA LRSGLTRNQV SNWFINARVR LWKPMIEEMY TEIHKKNRAE  480
GSCGQRRRHG NIYCQRNQTS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.14e-65TALE family protein