PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020687466.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 543aa    MW: 61434.1 Da    PI: 5.6278
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020687466.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.72e-084655031854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e++ LA + gLt +qV++WF N R +
  XP_020687466.1 465 MFQNflHPYPKDNEKQLLALRSGLTRNQVSNWFINARVR 503
                     5887779******************************88 PP

2BELL56.28.4e-19337406272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +q+ ++ k+ L+++l +Vd+r++q+ +q+q v+ssF+a a  gs ++ +++Al +iS  +++++  ia+ i
  XP_020687466.1 337 KQQSNSSKSELINMLAMVDQRFNQFLDQIQNVVSSFNAKAASGS-NLPAKFALTTISNFYKNIRSTIADEI 406
                     56778899***********************************9.899*******************9876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    
MMENGVFDPV SSLIDHSYMA MDGFSTSMLS GSHIMSGVSD HGRFRQILHT NPLYLTYKEE  60
VLRNMNHNGN SSIQNTNFRE NNVNSSIACS SLFTFDEMRN STSNGSCSTP NLSSKISKCS  120
KFVPQVHSGF LTSPKDDNSD FHLNCKEIYD EFSANQFSST LTSSSFHPSY LVGSSEQGTL  180
SFDNELSLRL GSSHPSVLNL PNVNDLYIDE SYSDKTQVMS SSGSGGGSKD INKMYNFTNE  240
NYLFENVQKF PNSGSSRVPL DLRYLHAIQE ILAELTSNAV EDVEEIDDSL ADLVSEANMS  300
SSSGSTVKGF RETGFNVLPF CSVENEYEQE MDCQPQKQQS NSSKSELINM LAMVDQRFNQ  360
FLDQIQNVVS SFNAKAASGS NLPAKFALTT ISNFYKNIRS TIADEIVSNG REPSSECMQE  420
EERNFESSFI QRQWDLQQLK QRDQPSWRPQ RGLPEKSVSV LRAWMFQNFL HPYPKDNEKQ  480
LLALRSGLTR NQVSNWFINA RVRLWKPMIE EMYTEIHKKN RAEGSCGQRR RHGNIYCQRN  540
QTS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.16e-65TALE family protein