PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020686614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 649aa    MW: 71464.3 Da    PI: 7.2998
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020686614.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.3e-093634001954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_020686614.1 363 FEHflHPYPKDSDKLMLAKQTGLTRSQVSNWFINARVR 400
                     664459******************************88 PP

2BELL119.61.4e-38225296172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqelq+kkakL+ +l eV++rY+qy++q+q+v+ssFeavag+gsa+ Yt+lAl++iS++FrcL+dai++q+
  XP_020686614.1 225 ERQELQMKKAKLVGMLGEVEQRYRQYHHQMQIVVSSFEAVAGHGSARTYTALALQTISKQFRCLRDAISGQL 296
                     79*******************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    
MATYFHGAPE IHPDGLQTLY LMNPGYVGYA DPAGAPAANM VFLNSGGITS LNPINLSHSP  60
PPNHQQQHFV GIPLPQPQEN SAGRFHYNLW SQAPATNLMG RGTTQQGLSL SLSPQQPHPY  120
GSYRAEAEVS APMPEMTIAG DDGVRPMGTT GPPGTAGIQS VLMNSKYLKA AQELLDEVVS  180
VGKGVGAETM KKNGEKSPMK SSKELDVKGE GESSGKREAE LTTAERQELQ MKKAKLVGML  240
GEVEQRYRQY HHQMQIVVSS FEAVAGHGSA RTYTALALQT ISKQFRCLRD AISGQLKATG  300
RSLGEEDCLV GGAKSIGSRL RLVDHHLRQQ RALQQLGMMQ HNAWRPQRGL PERAVSILRA  360
WLFEHFLHPY PKDSDKLMLA KQTGLTRSQV SNWFINARVR LWKPMVEEMY VEETKEHEQM  420
KPEEKSSYSE SNEDSTSKAS SQTKTEQANS FTSKKQDKSN EPKPSSSIAI PVTKFGISNN  480
HDEESLMQPF LKKVRNNESL HLNPLPHSLT LEMKPEEFSN RELLMKFMEA RSNANNGHAL  540
MNGGGNHGGG FNAYSIGDIG RFDTEQFTPS FHGNGVSLTL GLQHCESLSL TGTEPPYLSN  600
ESIPMGNEAN AFCSLNNNPQ ASHPSNAYES IDIQNRKRFA AQLLPDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-112TALE family protein