PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020680043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 302aa    MW: 33585.3 Da    PI: 6.1706
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020680043.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-092302642155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_020680043.1 230 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 264
                     569*****************************885 PP

2ELK39.71e-13184205122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_020680043.1 184 ELKGQLLRKYSGYLGSLKQEFL 205
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    
MENWSGGNNP LMIMPLLSST AAGANNPLLL HPQPPPPPPA DAYDTTLIKA KIISHPQYPR  60
LLSAYVNLHK VGAPPEVVAR LEEACASSLI SGGGGGGGGG EDPALDQFME AYCEMLTKYE  120
QELSKPFKEA MLFLSRIDSQ FKSLSLSLPP APSQVCADLE KNGSSEDDID LCDNYVDPEA  180
GDRELKGQLL RKYSGYLGSL KQEFLKKRKK GKLPKEARQQ LLDWWTRHYK WPYPSESQKL  240
ALAESTGLDQ KQINNWFINQ RKRHWKPSEE MQFVVMDAAH PHYFMDGGLA GNPFAIDCTP  300
LL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1200209LKQEFLKKRK
2206210KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-111TALE family protein