PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020679668.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 501aa    MW: 56720.3 Da    PI: 6.8189
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020679668.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.65.1e-092993361954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_020679668.1 299 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 336
                     564459******************************88 PP

2BELL114.46.1e-37160229372
            BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      elqk+kakLls+leeVd+rYk+y+eq+++v+ssFe +ag g+a+ Y +lA+ka+SrhFrcL+d i +qi
  XP_020679668.1 160 IELQKRKAKLLSMLEEVDRRYKRYCEQMKAVVSSFEDIAGEGAARTYSQLASKAMSRHFRCLRDGINGQI 229
                     69******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    
MMSHESHHLH HQHPFNEFSA MVGNSSAMNN FETGVGHDLF HMNMSSSNHN WRGFSQDSDA  60
TVSVAAASAW PLESDLHANQ VQSLSLSLYN PPPQPPSFQL SSHHPFHIKS CKYLLPTQEL  120
INEFCSLGGG NSFKRNNFAK PMDDSSSSWS QQSLYSMEPI ELQKRKAKLL SMLEEVDRRY  180
KRYCEQMKAV VSSFEDIAGE GAARTYSQLA SKAMSRHFRC LRDGINGQIK ATRRAMGENE  240
AAATATGLTR GETPRLKLLD QCLRQQKAFQ QAGMMESHPW RPQRGLPDRS VSILRAWLFE  300
HFLHPYPSDV DKHILARQTG LSRSQVSNWF INARVRLWKP MVEEMYMEEL KEDDKNSQSS  360
HATTMQEAGT SCNNPYSNPN PNPSPSSHLG AFEDRKPKTC HFQIDEQNSL SSIINNINTH  420
HHNPNPNPNQ NFGIIDTDFG SYHGHELTLS LQQHERPLLF TRELPIGDDG DEVQFSILEG  480
ESQNIPYRNL MGAQLLHDLA G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.22e-99TALE family protein