PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020678223.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 770aa    MW: 84493.3 Da    PI: 6.5309
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020678223.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-095836201954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+k+gL+ +qV++WF N R +
  XP_020678223.1 583 FEHflHPYPSDADKHLLARKTGLSRNQVSNWFINARVR 620
                     554459******************************88 PP

2BELL121.43.9e-39444514272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     r e+q+kk+kLls+l+eV+krY++y+eq+q+v++sF+ v+g g+a pYt+lA ka+SrhFrcLkdai+ q+
  XP_020678223.1 444 RFENQRKKSKLLSMLDEVEKRYNHYCEQMQMVVNSFDSVMGFGAAMPYTALARKAMSRHFRCLKDAITVQL 514
                     779****************************************************************9996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    
MLQGNIFSFS SSDDNDDDDE LERAQQNRHQ NRRSEKLRVQ SGLEVAVAAS HSHTLVPIEE  60
EVEDEEEEEE EEGGIYGAPL ATRGTNMLSE MFNYGGPADV LATAAAAHAH DTSTNPPAGY  120
HRMIQQIRPD FYGSNNRPQG LAFMSNTSAT ANIINTNNWI SSSSVLIDQD HVAALAAAKQ  180
HGLNSAATDS SSPSSSTAMR LFFMNPPPSA AAMQHHQRPS NSPNRHDDPH QSPMGPATLL  240
HHHHHHDQSQ VFLGGSDGAS IFGEGVSFGG GMRESQVGPS LSLSSSLQQL EMRKAEELRG  300
VRSQSGSAAA SLLFYNSQQQ QEQQLHTTSI HQPPQPPSTC LQSHASHQSQ GQYQQLHMSS  360
SSTYGSISTA NVLRNSKYAR AAQELLEEFC SVSRGHVRGN TTGMRSSSIN PNLLSHGGRG  420
VSSSTAAASS SSSKDIPALS PADRFENQRK KSKLLSMLDE VEKRYNHYCE QMQMVVNSFD  480
SVMGFGAAMP YTALARKAMS RHFRCLKDAI TVQLKQACEL LGDNDGGSGS GLTKGETPKL  540
RLIDQNLRQQ RAFHQMGMME QEAWRPQRGL PDRSVSILRS WLFEHFLHPY PSDADKHLLA  600
RKTGLSRNQV SNWFINARVR LWKPMVEDMY QQEAQEEDSQ INEEDQETNA PHRILLAAAP  660
TTQQQQKQPS HSPESDAPPE THVSITSRPQ LEHYGRLRHD APQTHDQPAA PPPHDLIASN  720
SLIFPPPPLD DEMYRRAAAT AAARTGDLSL TLGLRHAGGN APDAVGRFGL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.21e-121TALE family protein