PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020675640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 590aa    MW: 66083.7 Da    PI: 6.73
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020675640.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36.3e-093714081954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_020675640.1 371 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 408
                     664459******************************88 PP

2BELL107.48.9e-35234302472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     elqk+kakLl+lleeVd++Y++y+eq+++v+ssFe vag gsa+ Y +lA+ka+SrhFr+L+d i++qi
  XP_020675640.1 234 ELQKRKAKLLTLLEEVDRKYRRYCEQMRAVVSSFESVAGEGSATTYLALASKAMSRHFRSLRDGIVSQI 302
                     89******************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    
MAQEHQHQAA MGYGEYSMQG YEASGSHELY NLQTRMEMLG FPSKHHHHHQ QNQNQHNPET  60
SWRSGGLFLR PGSDSPASES LMISPDAVAD WDQPRQLVVD DSLRCLFPVH DEEQPSQGLS  120
LSLYNPEPSV VVDSAADYHR SLMFSRPTNS NSTVSHQQGF SFHSAQTSGS VSSSTHKLRL  180
SKYLIPTQEL LNEFCDLGGV KSSKQKQQSK RFEEGGPSSL SPVSPSLQNL DILELQKRKA  240
KLLTLLEEVD RKYRRYCEQM RAVVSSFESV AGEGSATTYL ALASKAMSRH FRSLRDGIVS  300
QIQAAKKTMG EKDPIAPGIS RGDTPRLKLL DQCFRQQKAF QQGGLLMEQH PWRPQRGLPE  360
RSVSILRAWL FEHFLHPYPS DVDKHILARQ TGLSRSQVSN WFINARVRLW KPMIEEMYTE  420
ELKEREIQST GAQEDDRNPN PSCSRDVAIT DEQKPLAAEL LTEPDSLSSI INHHSEARPH  480
HTNPRDQIQL QRTENFGIAD LHFSSYNGCG SQSYSGNGVS LTLGLQHHDG SGGGGGMGFS  540
LSPTNPQPLF YSRGQMEECQ PVQFSILDGE VQNLPYRNLM GAQLLHDLAG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-113TALE family protein