PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020674240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family TALE
Protein Properties Length: 399aa    MW: 45153.4 Da    PI: 6.5544
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020674240.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.58.1e-073423752154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e+++ L +++gL+ +q+ +WF N+R +
  XP_020674240.1 342 KWPYPTEEDKALLVQETGLQLKQINNWFINQRKR 375
                     569*****************************87 PP

2ELK28.92.6e-10296317122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_020674240.1 296 ELKHELKQGYKEKIVDIREEIL 317
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    
MAFPNHLLPQ EISMPAKQTS LVLKPTFPDE DEDLNPRSST QPPPPSHHLF PNGSNNVPTW  60
LNTAIHRDQQ AHHCSDNTRY IHLHTASDSS EDRWLHIPAG AGEVSRAAPT GQRRESGWDR  120
VQGDWQSARY KTEIMAHPLY EQLLSAHVAC LRIATPIDQL PRIDAQLARS REIVAKYSVL  180
CGGGAGEIAD GDGKELDRFM THYVLLLCSF REQLQQHVRV HAMEAVMACW ELEQSLQSLT  240
GISPNEGTGA TMSDDEDDNS DSGNNFYDGN LDEHDSMGFG LPTESERTLM ERVREELKHE  300
LKQGYKEKIV DIREEILRKR RAGKLPGETT SLLKAWWKSH SKWPYPTEED KALLVQETGL  360
QLKQINNWFI NQRKRNWHSS PSSSTMTKSK RKSNAGHTG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-143TALE family protein