PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_028102834.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Theaceae; Camellia; Camellia sinensis
Family E2F/DP
Protein Properties Length: 137aa    MW: 15919.8 Da    PI: 10.043
Description E2F/DP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_028102834.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1E2F_TDP35.41.7e-11681122470
         E2F_TDP  24 ivtlnevakeLvsedvknkrRRiYDilNVLealnliekkekneirwk 70 
                     i+ l+ v   +++++v  ++R iYDi+N Le+++liekk kn+ rwk
  XP_028102834.1  68 IILLQLVPVVMIAPSV--QKRHIYDIINDLEGIGLIEKKLKNRNRWK 112
                     5667777788899999..****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    
MSTSQANHLT EQIVPQQQHQ LPLKRQPPFS SMEPPFGDYH QFSSPALDLR LKEPEAIVVK  60
SPVLLQAIIL LQLVPVVMIA PSVQKRHIYD IINDLEGIGL IEKKLKNRNR WKYRWELMCQ  120
GQGRLIRMLL SYRCLSH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22220.34e-09E2F/DP family protein