PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023006947.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 668aa    MW: 73052.6 Da    PI: 6.4035
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023006947.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.6e-094675041954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_023006947.1 467 FEHflHPYPSDGDKHLLARQTGLSRNQVSNWFINARVR 504
                     664459******************************88 PP

2BELL121.82.9e-39324395172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r+e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF++v+g g+a pYt lA++a+SrhFrcLkdai+ q+
  XP_023006947.1 324 DRNEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDVVMGFGAAVPYTVLAQNAMSRHFRCLKDAITAQL 395
                     589******************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    
MSQQDYHQAA AAAAAATFFT PFTNGFDRSS TTATASHQDP QHQHYNHIAH QIRKEKLRLQ  60
GLDPPPPQPS LVGIEEEEDD QSAGAAALHH VYDSTGILSE MFNFPQPQRP QAEWYGNRQE  120
INASDSAVAM QLFLMNTNPR SPPPPPVSST LHMLLPNPSS GGSFGQFTWG VVPEQETGGG  180
GGGGGGGDYS SSNPNEGRLS LSLSSSIEAA KAEELRMGDS GLVYQNQHHP QQVQVGIGSS  240
SNSSLGVVNL LRNSKYVKPA RELLEEFCSV GRDQLKNNNN KFNKSNLTSN SNSHGGDGGG  300
GGVSSSTSKD QPQPPPPPAL SAADRNEHQR RKVKLLSMLD EVDRRYNHYC EQMQMVVNSF  360
DVVMGFGAAV PYTVLAQNAM SRHFRCLKDA ITAQLKHSCE MLGEKDGRGG GGGSGITKGE  420
TPRLKLLEQR LRQQRAFHQM GMMEQEAWRP QRGLPERSVN ILRAWLFEHF LHPYPSDGDK  480
HLLARQTGLS RNQVSNWFIN ARVRLWKPMV EDMYQQEAKQ HEEEEEQDDD HNNINNNNNT  540
DEDTQSNPPP TSSAAPPPPP PFSYYYSSSS SSSASTAVTQ AAVANCFPAT QYESELQDTC  600
RRVSVLTAPD QQMRTTSGSA KSDIPGPTRL IRFGTTSGDV SLTLGLRHAG NIPDNNPSFS  660
LRSEFGGC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-109TALE family protein