PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023006919.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 669aa    MW: 73000.9 Da    PI: 6.7303
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023006919.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-094134501954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  XP_023006919.1 413 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 450
                     664559******************************88 PP

2BELL124.54.1e-40275346172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e+q+lq+k +kLl +l+eVd+rY+qy++q+q+v+ssF+++ag+g++kpYt+lAl++iSrhFrcL+daia+q+
  XP_023006919.1 275 EKQDLQNKLTKLLYMLDEVDRRYNQYYHQMQIVVSSFDVIAGCGASKPYTALALQTISRHFRCLRDAIAGQV 346
                     6899*****************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    
MATYYSSSSN GRDATPILYS RGALIGSYED SSILPRNMMM HNSGMYMDSC PSQGDNGCGQ  60
ITSVGAAGTS QQQQEFLSNL GGSEIAEHDF NTWRGEGRSE MVGASSMRGP TNVLHGGQNL  120
QGQGLSLTLS TQIPSGIQMP SIPYRNSDMG LASFLSPNPT SSSDDGCRNG SSRDEQLTKG  180
GLSQYSMMST IARTMPNSKY LKAAQQLLDE AVNVRKALKR PNNERNQSSH EHETRSGKNG  240
DAGTKNDGSM VTASGASSIP QETGSNSTCE LSHAEKQDLQ NKLTKLLYML DEVDRRYNQY  300
YHQMQIVVSS FDVIAGCGAS KPYTALALQT ISRHFRCLRD AIAGQVRATR KSLGEHENSG  360
NDKGVGITRL RYVDQQLRQQ RALQQLGMIQ QHAWRPQRGL PENSVSILRA WLFEHFLHPY  420
PKDSDKIMLA RQTGLTRSQV SNWFINARVR LWKPMVEEMY KEEAGSAEMD SISSSENVGK  480
GTKGDNRTFE DNKEEDLQQS TSSTATERCS TGDIIDLKSD QASNLGNSGS TRLASFQNGA  540
HIEAQNELVK SREELRPNVN NSNFFPDAIV QSQAGSDRFM AAAAAYHMSE LGRFGAVSGV  600
SLTLGLQHCE GGGIPMPTGT QHGFAAMRGD EMYNAAASSL GDTGHFECVN AGNPQPRFGP  660
SHLYHDFVV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-121TALE family protein