PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023004610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 317aa    MW: 35238.4 Da    PI: 4.6382
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023004610.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-092632962255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp++ ++ eLA+++gL+ +q+ +WF N+R ++
  XP_023004610.1 263 WPYPTEMDKFELAESTGLDPKQINNWFINQRKRH 296
                     69*****************************885 PP

2ELK39.71e-13216237122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKY+gyL+sLkqEFs
  XP_023004610.1 216 ELKDRLLRKYGGYLSSLKQEFS 237
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    
MADLYGLHPL ADYSYESSSA APLDNLLVPV NFQAYSTASA DYSHWLQVFG SGHVPSVSSG  60
DYDAALAVVS EEESAGAIRE KIASHPLYPR LVDAFVDCQK IGAPPEVANI LGRSVRGRDI  120
GERTSGVSTC LGADPELDEF METYCGILAK YKLDLSLPFV EASSFLNNME TQLSSLCNGT  180
TRGYVSDETA AGSSEEDASA GEVELQDSLW ANEDRELKDR LLRKYGGYLS SLKQEFSKTK  240
KKVKLPKESR QILLDWWNVH CKWPYPTEMD KFELAESTGL DPKQINNWFI NQRKRHWKAS  300
ENMQFGDVHG VFTADPL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.19e-95TALE family protein