PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023003991.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 365aa    MW: 40985.1 Da    PI: 6.8427
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023003991.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-092933272155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_023003991.1 293 KWPYPSESQKLALAQSTGLDQKQINNWFINQRKRH 327
                     569*****************************885 PP

2ELK41.13.6e-14247268122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsg+LgsLkqEF+
  XP_023003991.1 247 ELKGQLLRKYSGCLGSLKQEFM 268
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    
MDGPGGSSSG MMNFGDQNNS NNGLCSSMMM MMPLMSSHQH HHHHHHHHHQ GDACNPFPPL  60
PSPNYTTNNI SNTNTSSSSN PICYLMDENT TINNNNNNDN GCGHANSSSC ELKAKIMGHP  120
HYHRLLAAYV NCRKVGAPPE VVARLEGACA SALTMSGTSC TGCIGEDPAL DQFMEAYCEM  180
LTKYEQELSK PFRDAMLFLH RIECQFKALS ISSSDAVCGE AFERNGSSEE EVDINGHSID  240
PQAEDRELKG QLLRKYSGCL GSLKQEFMKK RKKGKLPKEA RQQLLDWWSR HYKWPYPSES  300
QKLALAQSTG LDQKQINNWF INQRKRHWKP SEDMQFVVMD GGHPQYYMDT MLGNPFPLDI  360
SPTLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1263272LKQEFMKKRK
2269273KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-131TALE family protein