PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023003390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 694aa    MW: 76157.6 Da    PI: 7.2851
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023003390.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.6e-095005371954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_023003390.1 500 FEHflHPYPSDADKLLLARQTGLSRNQVSNWFINARVR 537
                     664559******************************88 PP

2BELL115.52.7e-37360431172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r e+q++k+kLls+l+eV++rY+ y+eq+q+v++sF+ v+g g+a+pYt+l +ka+SrhFrcLkdai+eq+
  XP_023003390.1 360 DRIEHQRRKVKLLSMLDEVERRYNLYREQMQMVVNSFDLVMGFGAAAPYTTLTQKAMSRHFRCLKDAITEQL 431
                     589*******************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    
MGIAKGPLIL SNKPTNCANS SMSHDYHPHQ GILAFSNPLD KSNSPSLPHQ IRRDKLRVDS  60
FSSDPLPPPP PTVAGIDEQL HHHHHHHHHQ QHLHHVYATS PTAGTMLSDM FNYPPTPSAT  120
PASVEFSDNF RTLRQPNSAS AMQLFLMNPP PPPPPPPPRS PSPPSTSSTL HMLLPNLPSG  180
SLQGFESGGV GDQTGFGQFA VAESQGLSLS LHSSSLQHLE DVGAGAKADE FRIRDGGMLY  240
NYNNNNNQVH GGGGNGSNSS ILQYSFRNNS ENSPHSFQMN PNHQVQIGFG SSLGVVNLLR  300
NSKYVKAAQE LLEEFCSVGR VQLKKTKSNM KQSHNNPETA AGGGASSSSS KDHPPLSATD  360
RIEHQRRKVK LLSMLDEVER RYNLYREQMQ MVVNSFDLVM GFGAAAPYTT LTQKAMSRHF  420
RCLKDAITEQ LKQSYEALGE KGGNGGSGIT KGETPRLKLL EQSLRQQRAF HQMGMMEQEA  480
WRPQRGLPER SVNILRAWLF EHFLHPYPSD ADKLLLARQT GLSRNQVSNW FINARVRLWK  540
PMVEEMYQIE GKDETDHSHQ QQPSKDDDDT TDNKIQNSAI NAQNPTPTTA TTSSVPPPST  600
TIAEEGAAGF TATHDQFSEL HDVWRHGSGQ HYGTMSEDAR AATDVSNGPT LIRFGTSGTT  660
TGDVSLTLGL RHAGNTSAAT MDNPSFSLRD FGHS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-124TALE family protein