PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023002602.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 305aa    MW: 35125.2 Da    PI: 5.8032
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023002602.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092312652155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++e+  LA+++gL+++q+ +WF N+R ++
  XP_023002602.1 231 KWPYPSEAEKLALAESTGLDQKQINNWFINQRKRH 265
                     579*****************************885 PP

2ELK36.11.4e-12185206122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++Ll+KYsgyL++LkqE+s
  XP_023002602.1 185 ELKNHLLKKYSGYLSTLKQELS 206
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    
MEDQYNPNFH YHHQQQHQQV HDFQISSGGS KDTDIMKAKI ISHSQFSNLL QAFLDCKKVG  60
APPEVAAELG SVGEEFEERR RCSMAASGGY SDPELDQFME GYYRMLVKYR EELTKPIQEA  120
ADFMLRIESQ LNTLCNGSFQ ILASDAATEE NRDGMGSSEE EQEKGGGEAE RDATEQIDPR  180
ADERELKNHL LKKYSGYLST LKQELSKKKK KGKLPKDARQ ELLRWWEVHS KWPYPSEAEK  240
LALAESTGLD QKQINNWFIN QRKRHWKPSE DVQLMGMEGF YHPNTAAAFY FDGRYMGDAH  300
YRLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-105TALE family protein