PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023002330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 467aa    MW: 51868.4 Da    PI: 5.138
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023002330.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.49.9e-084044372154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_023002330.1 404 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 437
                     469*****************************87 PP

2ELK28.72.9e-10358379122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_023002330.1 358 ELKHELKNGYKEKIVDIREEIL 379
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    
MAFRDQLSRG LPLRYGNQPP EEQSERPLDS TLRSILSDQL TDHSPAGDGS KSEHLLQSTP  60
NWLNSALLRN QTPHSQYSGD SMTTAADKDI TDFLNLHTTG TNSAVSHPTG QWLSRPILHR  120
NHSDVIDEVA DAADAMIGAT TTLSRESDDL KNNSCGGGGE DVNNSDDVAI ESDGNEGAQC  180
EEAIVNWQNA RAKAEILAHP LYEQLLSAHV ACLRIATPVD QLPRIDSQLA ESQNVAAKYS  240
SLGHGSQPVV GNGKEIDQFM THYVLLLCSF KEQLQQHVRF HAMEAVYACW EIEQSLQSLT  300
GVSPGEGTGA TMSDDEEDQI DSDAIMFDGC LEGHDATGFG PLIPTESEKS LMERVRHELK  360
HELKNGYKEK IVDIREEILR KRRAGKLPGD TTSVLKAWWQ SHSKWPYPTE EDKAKLVQET  420
GLQLKQINNW FINQRKRNWH ANPSTTTTMK TKRKRSNAGD TPCDDHQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1435455RKRNWHANPSTTTTMKTKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-176TALE family protein