PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023002143.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 501aa    MW: 55829.6 Da    PI: 5.7416
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023002143.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.5e-084394771854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  XP_023002143.1 439 MFQNflHPYPKDTEKHLLAVKSGLTRNQVSNWFINARVR 477
                     5887779******************************88 PP

2BELL53.84.7e-18316378770
            BELL   7 kkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiae 70 
                     +k+++Ll+l++ +d+rY q+ ++++tv s+F+a+++l++ +++ +   ++i+  +++L+++i++
  XP_023002143.1 316 AKRSHLLTLQQLIDERYTQCLDEIHTVTSAFHAATDLDP-RLHSHYTYQTITSVYKSLREKITN 378
                     799************************************.**********************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    
MASTNSVIVG EILPLRIPIA AGFPILLTLR ESGCPATDAD DHIVDQLGFL GSSPMFTAPQ  60
RNDLVDVSGG CLNLSSNAEF QDQLAGAIPI ASVSPVDAKD SAFSAPQFQQ LETFRTCFEH  120
SSSNASNSSF ASSLNCERDE SLCNANNEWE NGHFLYNQPI ARDNPVRSDF QTISSMENLV  180
QNGWMPSNTM NSKLWNELSL SLATSEPVIV GGTNFLDQYS QLTFSGATQP CLNNTELACN  240
SMDLSLSYSY GSSPVHPSQA ISGSRYLSVI QDILSQIASY PLESSDQVSH SSTTVGFVPF  300
SSSSLETQWP KPSGDAKRSH LLTLQQLIDE RYTQCLDEIH TVTSAFHAAT DLDPRLHSHY  360
TYQTITSVYK SLREKITNCI LAMGMHSNTV CTKEKEKSFE TTFIRKQLAL QQLKRKDNQL  420
WRAQRGLPEN SVSVLRAWMF QNFLHPYPKD TEKHLLAVKS GLTRNQVSNW FINARVRLWK  480
PMIEEMYAEM SRRKSFQNDE G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.12e-93TALE family protein