PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023000351.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 528aa    MW: 59005.1 Da    PI: 5.9565
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023000351.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.2e-103583951954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+ +LA+++gLt +qV +WF N R +
  XP_023000351.1 358 FEHflHPYPKDSEKLKLARQTGLTRNQVANWFINARVR 395
                     664459******************************88 PP

2BELL92.34.5e-30222293172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erq+l++k +kLlsll eVd+rYkqy++q q ++ssF+ vag g+a+ Yt+lA  +iS hFr L+dai  qi
  XP_023000351.1 222 ERQDLKNKNSKLLSLLGEVDRRYKQYYQQEQFLVSSFDLVAGRGAAEFYTALAHWTISCHFRRLRDAINAQI 293
                     799******************************************************************998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    
MTYFPSLSNP RESTLGDQKL GSSCQEQLLC SGNFMMFMNH QDPSCGDYSE IFSGVSSNYV  60
ESVGDRSNGE MGFIPPVVGI LDHSNFQCQG VSLSLSTHSP SVVSLPSFPS QYQTRALPSS  120
FICAPPSIFE QRSNPKLCMS DAKNGMYMSV AAANLVSNSI YVEAAQQLLD EVVSIGDALK  180
ELKSKKLKGS NDLTGEMCSD ATDSLLVNSS LVNLSSDLSP AERQDLKNKN SKLLSLLGEV  240
DRRYKQYYQQ EQFLVSSFDL VAGRGAAEFY TALAHWTISC HFRRLRDAIN AQIKTTRRTL  300
GEQDASHSGQ EGIPRLRFVD QQLRQQRTLQ QLGVTSHSWR PQRGLPESSV SILRAWLFEH  360
FLHPYPKDSE KLKLARQTGL TRNQVANWFI NARVRLWKPM VEEMYKEEFG DTNMDIKSSP  420
ENTSKPPWNN NSLFSEDRSG DKLHDNTKSA ASNNERVLYG PCSTDDMIKP SNFSVDGDVS  480
LALELKHCEG EEFGIFGSSN NRIGSIELET QDFQCRLPSS NMLHDFVV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.19e-82TALE family protein