PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022999570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 319aa    MW: 35881.5 Da    PI: 4.7617
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022999570.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.5e-092492832155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp++ee+ +L+  +gL+++q+ +WF N+R ++
  XP_022999570.1 249 KWPYPTEEEKSKLSVITGLDQKQINNWFINQRKRH 283
                     569*****************************885 PP

2ELK34.83.6e-12203224122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     +LK++Ll+KYsgyL+sLk+EF+
  XP_022999570.1 203 DLKEMLLKKYSGYLSSLKKEFL 224
                     6********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    
MEEFYRLNNP VMSSYSNGVL GGEAIASTSC GDIHEALMVD DELLHLEAEP TTGLNMSDMI  60
KTQIINHPLY PKLVSAYIEC QKVGAPPQVA SLLEEIGREN HPSRSCIELG ADPQLDNFMS  120
YCEVLHQYKN ELSKPFDEAA MFLTNIELEL SNLCKGSFTA TSESRSAIDD EVAGTPEEEP  180
SSYGEVETSG NHEPFSTRKT NQDLKEMLLK KYSGYLSSLK KEFLKKRKKE KLPKDARMAL  240
LEWWSAHYKW PYPTEEEKSK LSVITGLDQK QINNWFINQR KRHWKPPEDM RFMLMDGAGV  300
GDGDGDGDGG CIKGLNQAI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1219228LKKEFLKKRK
2225229KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.14e-69TALE family protein