PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022999569.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 320aa    MW: 36010.6 Da    PI: 4.7133
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022999569.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.5e-092502842155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp++ee+ +L+  +gL+++q+ +WF N+R ++
  XP_022999569.1 250 KWPYPTEEEKSKLSVITGLDQKQINNWFINQRKRH 284
                     569*****************************885 PP

2ELK34.83.7e-12204225122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     +LK++Ll+KYsgyL+sLk+EF+
  XP_022999569.1 204 DLKEMLLKKYSGYLSSLKKEFL 225
                     6********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    
MEEFYRLNNP VMSSYSNGVL GGEAIASTSC GDIHEALMVD DELLHLEAEP TTGLNMSDMI  60
KTQIINHPLY PKLVSAYIEC QKVGAPPQVA SLLEEIGREN HPSRSCIELG ADPQLDNFME  120
SYCEVLHQYK NELSKPFDEA AMFLTNIELE LSNLCKGSFT ATSESRSAID DEVAGTPEEE  180
PSSYGEVETS GNHEPFSTRK TNQDLKEMLL KKYSGYLSSL KKEFLKKRKK EKLPKDARMA  240
LLEWWSAHYK WPYPTEEEKS KLSVITGLDQ KQINNWFINQ RKRHWKPPED MRFMLMDGAG  300
VGDGDGDGDG GCIKGLNQAI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1220229LKKEFLKKRK
2226230KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.11e-71TALE family protein